BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1133 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) 70 2e-12 SB_35244| Best HMM Match : Ldl_recept_b (HMM E-Value=3.2e-11) 29 2.8 SB_2330| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_52524| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) 29 5.0 SB_39025| Best HMM Match : DNA_pol_B_2 (HMM E-Value=6.2) 29 5.0 SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) 29 5.0 SB_56989| Best HMM Match : DUF1103 (HMM E-Value=2.4) 28 6.6 SB_55600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 28 8.7 SB_33960| Best HMM Match : Borrelia_orfA (HMM E-Value=2) 28 8.7 SB_20656| Best HMM Match : DNA_pol_B_2 (HMM E-Value=5.3) 28 8.7 SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_9405| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00011) 28 8.7 SB_9274| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_7413| Best HMM Match : ATP_bind_1 (HMM E-Value=0) 28 8.7 SB_2134| Best HMM Match : Endonuclease_7 (HMM E-Value=0.057) 28 8.7 SB_56692| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1e-04) 28 8.7 SB_42326| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00028) 28 8.7 SB_38170| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_31660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_15052| Best HMM Match : Pox_A32 (HMM E-Value=0.0023) 28 8.7 SB_13027| Best HMM Match : DNA_pol_B_2 (HMM E-Value=5.4) 28 8.7 SB_11065| Best HMM Match : WD40 (HMM E-Value=1.7e-35) 28 8.7 >SB_8484| Best HMM Match : Heme_oxygenase (HMM E-Value=0) Length = 820 Score = 70.1 bits (164), Expect = 2e-12 Identities = 47/174 (27%), Positives = 88/174 (50%), Gaps = 3/174 (1%) Frame = +3 Query: 99 MRKATRKIHSVSDALVNAKFAISLRDHTVWGGGLFV-FYHIFAYLED-AKERLNMPEFNK 272 ++K T+ +H ++ + K R + W L Y++++ LE+ +++ + P F Sbjct: 522 LKKGTKVVHRAAENVHFVKEFARGRIESYWYRVLLADLYYVYSVLEEESRKHKDHPCFGP 581 Query: 273 LFVHEILYRKKAFEQDLQHYLGDNWRS-IPKSLALENYLQHLQDLERDNPKLLMAYVYHL 449 + E L R ++ ++DL Y G++W I S A + Y+ L+ + ++P+LL+ + Y Sbjct: 582 IHFPEKLERTESIKEDLAFYYGEDWEEQIKLSDATKEYVDRLKAISAEDPRLLIPHHYTR 641 Query: 450 YLGLLSGGQILSKKRRVFGEKNEQPNTYVDKVTDLAAVDISKLKNEFREAMNQI 611 YLG LSGG IL KK V K + V T + + KN +R ++++ Sbjct: 642 YLGDLSGGAIL-KKMAVKAMKLPETGEGVKFFTFDKVANAKEFKNHYRSRLDKL 694 >SB_35244| Best HMM Match : Ldl_recept_b (HMM E-Value=3.2e-11) Length = 534 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/52 (32%), Positives = 29/52 (55%) Frame = -2 Query: 344 VVTKVVLQILLKCLLSVKNFMHKQLIKFWHI*SLFCIFKICKNVVEDKQAST 189 ++T +++Q+L + LLS M KQL+ FW L+ F+I + + D T Sbjct: 42 IITTIIIQVLTRFLLSSDMHMDKQLL-FWS--ELYPEFRIRRMNLTDGSVQT 90 >SB_2330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 571 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/27 (40%), Positives = 21/27 (77%) Frame = +1 Query: 118 KYILSAMPWSMRSLRYR*ETIQYGVEA 198 +Y + A+ +SM++L+Y +T+QY V+A Sbjct: 5 QYSVKALEYSMKALQYSMKTLQYSVKA 31 >SB_52524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 481 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 321 LQHYLGDNWRSIPKSLALENYLQH 392 L +L D W +P +L L NYL H Sbjct: 334 LYSHLQDGWSQVPDALTLVNYLVH 357 >SB_48886| Best HMM Match : 4F5 (HMM E-Value=0.037) Length = 476 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 321 LQHYLGDNWRSIPKSLALENYLQH 392 L +L D W +P +L L NYL H Sbjct: 180 LYSHLQDGWSQVPDALTLVNYLVH 203 >SB_39025| Best HMM Match : DNA_pol_B_2 (HMM E-Value=6.2) Length = 478 Score = 28.7 bits (61), Expect = 5.0 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 155 HDLHNDYPLAPESIGLSNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 212 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 213 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 245 >SB_9492| Best HMM Match : Rho_N (HMM E-Value=2.1e-12) Length = 1970 Score = 28.7 bits (61), Expect = 5.0 Identities = 22/92 (23%), Positives = 41/92 (44%) Frame = +3 Query: 330 YLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFGE 509 ++GD S P+S+ L + + +L ++ LY+ G ++ R V E Sbjct: 1048 WMGDQELSAPESIGLGKVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTFE 1105 Query: 510 KNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 ++ Y+D TDL A + + +F + MN Sbjct: 1106 ESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 1137 >SB_56989| Best HMM Match : DUF1103 (HMM E-Value=2.4) Length = 835 Score = 28.3 bits (60), Expect = 6.6 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 140 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHRETLRLYVSF--GLKVTKIHRGVTF 197 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 198 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 230 >SB_55600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 971 Score = 28.3 bits (60), Expect = 6.6 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 876 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHRETLRLYVSF--GLKVTKIHRGVTF 933 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 934 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 966 >SB_24442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 673 Score = 28.3 bits (60), Expect = 6.6 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -2 Query: 236 IFKICKNVVEDKQASTPYCMVSQRYRKLRIDQGIADRMYFPSRFSHACRE 87 +FK C + E K P C++ R+ + +++ A R+ S SH+ ++ Sbjct: 179 VFKTCTVLSEKKSRKLPRCLI--RHHSMNLEKKCATRVTSESLDSHSSKD 226 >SB_34401| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 2629 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 1394 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 1451 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 1452 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 1484 >SB_33960| Best HMM Match : Borrelia_orfA (HMM E-Value=2) Length = 662 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 64 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 121 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 122 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 154 >SB_20656| Best HMM Match : DNA_pol_B_2 (HMM E-Value=5.3) Length = 379 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 155 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 212 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 213 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 245 >SB_15820| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1998 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 1026 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 1083 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 1084 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 1116 >SB_9405| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00011) Length = 1092 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 885 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 942 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 943 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 975 >SB_9274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 27.9 bits (59), Expect = 8.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 153 KFAISLRDHTVWGGGLFVFYH 215 K + + +H +WG GLFV +H Sbjct: 289 KDCLFVSNHAIWGAGLFVEFH 309 >SB_7413| Best HMM Match : ATP_bind_1 (HMM E-Value=0) Length = 299 Score = 27.9 bits (59), Expect = 8.7 Identities = 27/105 (25%), Positives = 42/105 (40%), Gaps = 2/105 (1%) Frame = +3 Query: 90 TTRMRKATRKIHSVSDALVNAKFAISLRDHTVWGGGLFVFYHIFAYLEDAKERLNMPEFN 269 TT M TR + V D + + T G G+ F ED ER PE+ Sbjct: 142 TTYMSSLTRSMSLVLDEFYQNLDCVGVSSMT--GAGIDEFLLAVGRAEDEYEREYKPEYE 199 Query: 270 KLFVHEILYRKKAFEQDLQHYLGD--NWRSIPKSLALENYLQHLQ 398 KL ++ +K + ++ D +S+P + A E L H + Sbjct: 200 KLKKEKLQKEEKEKTEQMEKLKKDLGEGQSVPLT-ATEQALLHTE 243 >SB_2134| Best HMM Match : Endonuclease_7 (HMM E-Value=0.057) Length = 1124 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 349 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 406 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 407 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 439 >SB_56692| Best HMM Match : DNA_pol_B_2 (HMM E-Value=1e-04) Length = 963 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 606 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 663 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 664 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 696 >SB_42326| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.00028) Length = 577 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 368 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 425 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 426 EESAWLGPYIDLNTDLRAKATNDFEKDFFKLMN 458 >SB_38170| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 115 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 172 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 173 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 205 >SB_31660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1185 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 960 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 1017 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 1018 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 1050 >SB_31526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1248 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 951 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 1008 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 1009 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 1041 >SB_15052| Best HMM Match : Pox_A32 (HMM E-Value=0.0023) Length = 1901 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 224 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 281 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 282 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 314 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 823 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 880 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 881 EESAWLEPYIDLNTDLRAKATNDFEKDFFKLMN 913 >SB_13027| Best HMM Match : DNA_pol_B_2 (HMM E-Value=5.4) Length = 398 Score = 27.9 bits (59), Expect = 8.7 Identities = 22/93 (23%), Positives = 42/93 (45%) Frame = +3 Query: 327 HYLGDNWRSIPKSLALENYLQHLQDLERDNPKLLMAYVYHLYLGLLSGGQILSKKRRVFG 506 H L +++ P+S+ L N + + +L ++ LY+ G ++ R V Sbjct: 155 HDLHNDYPLAPESIGLGNVDKLVPNLNDKTKYVIHHETLRLYVSF--GLKVTKIHRGVTF 212 Query: 507 EKNEQPNTYVDKVTDLAAVDISKLKNEFREAMN 605 E++ Y+D TDL A + + +F + MN Sbjct: 213 EESAWLGPYIDLNTDLRAKATNDFEKDFFKLMN 245 >SB_11065| Best HMM Match : WD40 (HMM E-Value=1.7e-35) Length = 702 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/54 (25%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 135 DALVNAKFAISLRDH-TVWGGGLFVFYHI-FAYLEDAKERLNMPEFNKLFVHEI 290 D++V+ +A+ +W GG+ +I Y +D+K + + E ++L HE+ Sbjct: 341 DSIVHLNWAVKNEQRKAIWLGGIMSLSYITLEYAKDSKFPIKITEAHRLKYHEV 394 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,763,676 Number of Sequences: 59808 Number of extensions: 465866 Number of successful extensions: 1156 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1087 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -