BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-1121
(535 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
U95740-1|AAC31662.1| 1199|Homo sapiens Unknown gene product prot... 32 1.1
>U95740-1|AAC31662.1| 1199|Homo sapiens Unknown gene product protein.
Length = 1199
Score = 32.3 bits (70), Expect = 1.1
Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
Frame = +3
Query: 222 LFSLVFLFLIALSVYLFIYLFCDISFIPFIILFALFSDIYRIASYIIYLRIFACHI--LL 395
+F ++F+F I + V +++F + F+ FI++F +D + L +FA ++ LL
Sbjct: 891 VFFVIFIFFIFVFVQFVVFVFFIVVFVFFIVVFVFTNDKMEECVKLTSLYLFAKNVRSLL 950
Query: 396 RAY 404
Y
Sbjct: 951 HTY 953
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 47,031,495
Number of Sequences: 237096
Number of extensions: 653982
Number of successful extensions: 1437
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1364
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1420
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 5216942984
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -