BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1121 (535 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U95740-1|AAC31662.1| 1199|Homo sapiens Unknown gene product prot... 32 1.1 >U95740-1|AAC31662.1| 1199|Homo sapiens Unknown gene product protein. Length = 1199 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = +3 Query: 222 LFSLVFLFLIALSVYLFIYLFCDISFIPFIILFALFSDIYRIASYIIYLRIFACHI--LL 395 +F ++F+F I + V +++F + F+ FI++F +D + L +FA ++ LL Sbjct: 891 VFFVIFIFFIFVFVQFVVFVFFIVVFVFFIVVFVFTNDKMEECVKLTSLYLFAKNVRSLL 950 Query: 396 RAY 404 Y Sbjct: 951 HTY 953 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,031,495 Number of Sequences: 237096 Number of extensions: 653982 Number of successful extensions: 1437 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1420 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 5216942984 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -