BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1121 (535 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g45620.1 68415.m05672 nucleotidyltransferase family protein l... 27 7.9 >At2g45620.1 68415.m05672 nucleotidyltransferase family protein low similarity to SP|O13833| Caffeine-induced death protein 1 {Schizosaccharomyces pombe}; contains Pfam profiles PF03828: PAP/25A associated domain, PF01909: Nucleotidyltransferase domain Length = 764 Score = 27.1 bits (57), Expect = 7.9 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -2 Query: 189 KIRLIKISYKTFRNKIHKYGYRTRVSGEILI*YKENIQKQNEL 61 K R++K+ Y RN IH+Y + LI +E ++KQ +L Sbjct: 417 KARMVKM-YMACRNDIHRYDATFIAIYKSLIPAEEELEKQRQL 458 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,289,176 Number of Sequences: 28952 Number of extensions: 100054 Number of successful extensions: 271 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 984125600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -