BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1107 (569 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 22 3.7 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 3.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 3.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 22 4.9 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 22 4.9 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 22.2 bits (45), Expect = 3.7 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +2 Query: 419 KMDYEK--KKYQHCQDHMSSRSSIRDLSKLKSFIENIQMK 532 K+D E+ + +C+D S S + L+ FI+N MK Sbjct: 90 KLDSEQVNRLVNNCKDITESNSCKKSSKLLQCFIDNNLMK 129 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 419 KMDYEKKKYQHCQDHMSSRSSIRDLSKLKSFIENIQMKYLY 541 K + E +KY+ S + R+ SK I ++ Y Y Sbjct: 51 KNEREYRKYRETSKERSQDRTERETSKEPKIISSLSNNYKY 91 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 3.7 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +2 Query: 419 KMDYEKKKYQHCQDHMSSRSSIRDLSKLKSFIENIQMKYLY 541 K + E +KY+ S + R+ SK I ++ Y Y Sbjct: 51 KNEREYRKYRETSKERSQDRTERETSKEPKIISSLSNNYKY 91 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +1 Query: 376 YIEASIRLKELHEDKDGLRKEEISALSGPHEFQEFYSRLKQIKEFHR 516 Y E R ++LH +K+ L +E S + + K KE+ + Sbjct: 12 YKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRK 58 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 21.8 bits (44), Expect = 4.9 Identities = 12/47 (25%), Positives = 21/47 (44%) Frame = +1 Query: 376 YIEASIRLKELHEDKDGLRKEEISALSGPHEFQEFYSRLKQIKEFHR 516 Y E R ++LH +K+ L +E S + + K KE+ + Sbjct: 12 YKEKDRRYEKLHNEKEKLLEERTSRKRYSRSREREQNSYKNEKEYRK 58 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,788 Number of Sequences: 438 Number of extensions: 2845 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16381902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -