Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= brS-1100
         (458 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY070257-1|AAL59656.1|  217|Anopheles gambiae glutathione S-tran...    24   2.9  
AJ821850-1|CAH25390.1|  426|Anopheles gambiae alpha-2,6-sialyltr...    23   6.8  

>AY070257-1|AAL59656.1|  217|Anopheles gambiae glutathione
           S-transferase e8 protein.
          Length = 217

 Score = 23.8 bits (49), Expect = 2.9
 Identities = 7/13 (53%), Positives = 11/13 (84%)
 Frame = +2

Query: 233 IYNLICFNLGILF 271
           ++N++CFN G LF
Sbjct: 96  VFNMLCFNNGCLF 108


>AJ821850-1|CAH25390.1|  426|Anopheles gambiae
           alpha-2,6-sialyltransferase protein.
          Length = 426

 Score = 22.6 bits (46), Expect = 6.8
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +2

Query: 2   PRAAFLTLLERKVLGYIQIRKGPNKVGFIGL 94
           PR+ +      + L  + IRK P   GFIGL
Sbjct: 318 PRSIWRAWTALQDLTDVPIRKNPPTSGFIGL 348


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 251,147
Number of Sequences: 2352
Number of extensions: 3947
Number of successful extensions: 26
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 39544623
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)