BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1097 (712 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0631 - 25656885-25657000,25658591-25658658,25658957-256589... 29 4.8 01_03_0169 - 13405789-13407504 28 8.4 >11_06_0631 - 25656885-25657000,25658591-25658658,25658957-25658996, 25659742-25659820,25659918-25661707,25662030-25662037, 25662305-25662367,25662504-25662820 Length = 826 Score = 28.7 bits (61), Expect = 4.8 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -2 Query: 636 LGLELHREATVRVDDASCISLEIMNEMNAAAIVNNRDLFDSLPDVQFLT 490 L +E+ R+ VR+DDA +S+ I + AA V R L S + FL+ Sbjct: 382 LFVEMRRDG-VRIDDAFVLSIVIGGSADLAAFVLGRQLHGSTMRLGFLS 429 >01_03_0169 - 13405789-13407504 Length = 571 Score = 27.9 bits (59), Expect = 8.4 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -2 Query: 585 CISLEIMNEMNAAAIVNNRDLFDSLPDVQF 496 C+ L +M AA ++ +R F+SLP++ F Sbjct: 506 CVPLTMMRAPGAAGLMISRAAFESLPELYF 535 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,338,852 Number of Sequences: 37544 Number of extensions: 396301 Number of successful extensions: 1030 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1010 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1030 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -