BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1097 (712 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1751| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 SB_56032| Best HMM Match : zf-CCHC (HMM E-Value=0.00047) 28 8.6 >SB_1751| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 341 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +3 Query: 213 KRSATMLVCMFLMALVVAATSIAGGVLLYRQYVRI 317 K + ML+C F L++ I GG L Y +I Sbjct: 77 KENKCMLICFFAFLLLLLILEIVGGALAYNNKDKI 111 >SB_56032| Best HMM Match : zf-CCHC (HMM E-Value=0.00047) Length = 632 Score = 27.9 bits (59), Expect = 8.6 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = -2 Query: 540 VNNRDLFDS-----LPDVQFLTQRRDQLVSGGLV*SAHNLHNQA 424 VN++DLFD+ L ++Q + RD ++ GGL HN + +A Sbjct: 576 VNSQDLFDAEMNRILSELQRVLNNRDDILIGGLNEDDHNKNVEA 619 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,706,064 Number of Sequences: 59808 Number of extensions: 438237 Number of successful extensions: 929 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 928 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -