BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1087 (382 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4CTP3 Cluster: Putative uncharacterized protein; n=2; ... 31 9.6 >UniRef50_Q4CTP3 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 405 Score = 30.7 bits (66), Expect = 9.6 Identities = 17/64 (26%), Positives = 31/64 (48%) Frame = -2 Query: 309 K*LFEAIVIRKNISRNRTNTIQIMGGIETRVRIRNKSGTSQFFVELFDLICSTEYDFYLV 130 K LF I + R + + I +R+R+ + T+ F ++ ++ EY+ YLV Sbjct: 224 KWLFGLFRITLGAAEERQSLLIFFQWIGSRLRVVRQGPTTHIFPKMASILAPYEYEVYLV 283 Query: 129 FTQN 118 TQ+ Sbjct: 284 GTQD 287 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 246,945,279 Number of Sequences: 1657284 Number of extensions: 3469404 Number of successful extensions: 6197 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6196 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 14868845845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -