BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1086 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 25 1.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 25 2.3 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.9 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 25.4 bits (53), Expect = 1.7 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = +3 Query: 468 MKEIDPYYNRYSSMVHHAGSHYDNVRINKPDEFDMVIEIGV 590 +KE+ YNR +S+ +H H ++I + D + ++E V Sbjct: 866 LKELFLQYNRIASIANHTFDHLHGLKILRLDH-NRLVEFNV 905 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 25.0 bits (52), Expect = 2.3 Identities = 15/62 (24%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = +3 Query: 408 SDFELHYKVLDTIFQ--NLHKKMKEIDPYYNRYSSMVHHAGSHYDNVRINKPDEFDMVIE 581 S E + +LD + N H++ K D YY Y H ++ N + D + Sbjct: 942 SSMETFFDLLDKQYDSYNKHQEYKSSDYYYKYYKQYPHLFKDYFSQYNKNHKYQNDYYEQ 1001 Query: 582 IG 587 G Sbjct: 1002 FG 1003 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 6.9 Identities = 13/64 (20%), Positives = 31/64 (48%), Gaps = 1/64 (1%) Frame = +3 Query: 327 KVPYNPKITNLESLLADISVRYIQLKESDF-ELHYKVLDTIFQNLHKKMKEIDPYYNRYS 503 KV Y+ ++ ++ R ++++E + E+ ++ T + L +KE +Y + Sbjct: 1700 KVTYHNRMGRPVQVVVYDDPRTVRVREIIYDEIDRPIMQTKWTKLTSHLKEYFAFYENFI 1759 Query: 504 SMVH 515 + VH Sbjct: 1760 TQVH 1763 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 673,381 Number of Sequences: 2352 Number of extensions: 11598 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -