BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1084 (439 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 1.5 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 2.6 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 4.5 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 4.5 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 4.5 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 4.5 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 4.5 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 4.5 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 4.5 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 4.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 4.5 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 5.9 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 1.5 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 2/33 (6%) Frame = -2 Query: 348 FGHSLVVAGGVPNMEP--VADPPNIEFCVVTLK 256 + H L+ G N + + DP NIEF + +K Sbjct: 186 WNHQLISYAGYKNPDGTIIGDPANIEFTELCMK 218 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 326 EHRIIPSHYIEQIPAPVYYGNFPPRPI 352 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 78 EHRIIPSHYIEQIPVPVYYGNFPPRPI 104 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 311 EHRIIPSHYIEQIPVPVYYGNFPPRPI 337 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 3/27 (11%) Frame = +3 Query: 267 QHKIL---YLEDLRRVPYLGHHQPRPV 338 +H+I+ Y+E + Y G+ PRP+ Sbjct: 327 EHRIIPSHYIEQIPVPVYYGNFPPRPI 353 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 5.9 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +2 Query: 2 KQPDTPATSSTTSIFSAVNESSK 70 ++PD PA+SS +S ++V S + Sbjct: 587 EKPDKPASSSASSAPTSVCSSPR 609 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,622 Number of Sequences: 438 Number of extensions: 2769 Number of successful extensions: 21 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11327868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -