BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1081 (350 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 22 1.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 1.8 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 1.8 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 3.2 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 3.2 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 3.2 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 3.2 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 3.2 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 4.2 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 4.2 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 4.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 4.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 4.2 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 21 5.6 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 21 5.6 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 5.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 5.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 5.6 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 5.6 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 5.6 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 5.6 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 5.6 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 5.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 5.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 21 5.6 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 21 5.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 21 5.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 5.6 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 5.6 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 5.6 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 5.6 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 21 5.6 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 5.6 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 5.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 21 5.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 21 5.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 21 5.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 21 5.6 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 5.6 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 5.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 5.6 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 5.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 5.6 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 5.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 5.6 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 5.6 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 5.6 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 5.6 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 5.6 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 5.6 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 5.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 5.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 5.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 5.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 5.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 5.6 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 5.6 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 5.6 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 5.6 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 20 7.4 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 20 7.4 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 20 7.4 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 20 7.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 20 7.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 20 7.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 20 7.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 20 7.4 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 20 9.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 20 9.8 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 20 9.8 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 20 9.8 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.2 bits (45), Expect = 1.8 Identities = 8/31 (25%), Positives = 15/31 (48%) Frame = -1 Query: 239 KSLVEFLRSDFMVINIQLLFEIF*ISWFPFF 147 + L +F + + ++ +F I W PFF Sbjct: 322 RKLAKFAKEKKAAKTLGIVMGVFIICWLPFF 352 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 114 KMGETSRKPPAKKRKPGDLEDLKQELDID 200 K + R+ K++ PGD+E + E D D Sbjct: 1762 KSVSSRRRQQRKQQTPGDVESDESESDPD 1790 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 1.8 Identities = 10/29 (34%), Positives = 16/29 (55%) Frame = +3 Query: 114 KMGETSRKPPAKKRKPGDLEDLKQELDID 200 K + R+ K++ PGD+E + E D D Sbjct: 1758 KSVSSRRRQQRKQQTPGDVESDESESDPD 1786 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 3.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -1 Query: 200 INIQLLFEIF*ISWFPFF 147 I + ++ +F I W PFF Sbjct: 272 ITVGVIMGVFLICWVPFF 289 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K EKT +R+ RS+ Sbjct: 25 EKEKFLEEKTSRKRYSRSR 43 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K EKT +R+ RS+ Sbjct: 25 EKEKFLEEKTSRKRYSRSR 43 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K EKT +R+ RS+ Sbjct: 25 EKEKFLEEKTSRKRYSRSR 43 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.4 bits (43), Expect = 3.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K EKT +R+ RS+ Sbjct: 25 EKEKFLEEKTSRKRYSRSR 43 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 26 EEKHLRERTSRRRYSRSR 43 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 274 EEKHLRERTSRRRYSRSR 291 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 4.2 Identities = 8/18 (44%), Positives = 13/18 (72%) Frame = +2 Query: 128 KQKTSREKTETRRFRRSQ 181 ++K RE+T RR+ RS+ Sbjct: 275 EEKHLRERTSRRRYSRSR 292 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSCKRYSRSR 43 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSCKRYSRSR 43 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSCKRYSRSR 43 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSCKRYSRSR 43 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKLLEERTSRKRYSRSR 43 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSRKRYSRSR 265 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSRKRYSRSR 265 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSCKRYSRSR 276 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSCKRYSRSR 276 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSCKRYSRSR 276 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSCKRYSRSR 276 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSCKRYSRSR 276 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSCKRYSRSR 265 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSRKRYSRSR 265 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSRKRYSRSR 265 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 247 EKEKLLEERTSRKRYSRSR 265 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 263 EKEKLLEERTSRKRYSRSR 281 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 20.6 bits (41), Expect = 5.6 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKLLEERTSRKRYSRSR 276 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 25 EKEKFLEERTSRKRYSRSR 43 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 20.2 bits (40), Expect = 7.4 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -1 Query: 194 IQLLFEIF*ISWFPFF 147 + ++ +F I W PFF Sbjct: 621 LAIVLGVFLICWLPFF 636 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKFLEERTSRKRYSRSR 276 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.2 bits (40), Expect = 7.4 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKFLEERTSRKRYSRSR 276 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 20.2 bits (40), Expect = 7.4 Identities = 6/18 (33%), Positives = 12/18 (66%) Frame = +1 Query: 190 WILITIKSLLRNSTKDLN 243 W +T+K L ++ +D+N Sbjct: 59 WDQMTVKELANSAKRDIN 76 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 25 EKEKLLEERTSRNRYSRSR 43 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T +R+ RS+ Sbjct: 258 EKEKFLEERTSHKRYSRSR 276 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 19.8 bits (39), Expect = 9.8 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +2 Query: 125 DKQKTSREKTETRRFRRSQ 181 +K+K E+T R+ RS+ Sbjct: 258 EKEKLLEERTSRERYSRSR 276 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,364 Number of Sequences: 438 Number of extensions: 2676 Number of successful extensions: 105 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8060325 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -