BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1081 (350 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g04160.1 68414.m00406 myosin family protein contains Pfam pro... 30 0.50 At4g11730.1 68417.m01871 ATPase, plasma membrane-type, putative ... 29 0.87 At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR ... 29 1.2 At1g23190.1 68414.m02897 phosphoglucomutase, cytoplasmic, putati... 27 2.7 At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pf... 27 3.5 At1g71360.1 68414.m08237 expressed protein low similarity to PIR... 27 3.5 At2g36580.1 68415.m04486 pyruvate kinase, putative similar to py... 26 6.1 At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containi... 26 8.1 At4g28715.1 68417.m04107 myosin heavy chain, putative similar to... 26 8.1 At3g07730.1 68416.m00933 expressed protein 26 8.1 At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam ... 26 8.1 At1g50460.1 68414.m05656 hexokinase, putative similar to hexokin... 26 8.1 >At1g04160.1 68414.m00406 myosin family protein contains Pfam profiles: PF02736 myosin N-terminal SH3-like domain, PF00063 myosin head (motor domain), PF00612 IQ calmodulin-binding motif, PF01843: DIL domain Length = 1500 Score = 29.9 bits (64), Expect = 0.50 Identities = 15/55 (27%), Positives = 30/55 (54%) Frame = +3 Query: 147 KKRKPGDLEDLKQELDIDYHKVTPEELYQRFKRTRKMALVMQKRKRT*KETAPML 311 +KR DLE+ K++ + Y + EE+ +FK T + + ++ +T E P++ Sbjct: 908 EKRMRTDLEEAKKQENAKYES-SLEEIQNKFKETEALLIKEREAAKTVSEVLPII 961 >At4g11730.1 68417.m01871 ATPase, plasma membrane-type, putative / proton pump, putative similar to plasma membrane-type ATPase SP|P20431 and SP|P19456 {Arabidopsis thaliana}; contains InterPro accession IPR001757: ATPase, E1-E2 type Length = 813 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/32 (40%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Frame = +3 Query: 162 GD-LEDLKQELDIDYHKVTPEELYQRFKRTRK 254 GD LED+K E+D D K+ EE++++ + +R+ Sbjct: 4 GDSLEDIKIEIDDDLEKIPIEEVFKKLRCSRE 35 >At5g66900.1 68418.m08433 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 809 Score = 28.7 bits (61), Expect = 1.2 Identities = 21/43 (48%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +1 Query: 133 ENLPRKNGNQEI*KISNRSWILITIK-SLLRNSTKDLNAPGKW 258 ENL RK N EI + + W L TI SLL ST DL + KW Sbjct: 499 ENLERKRLNLEILENTFPDWCLNTINASLLSISTDDLFS-SKW 540 >At1g23190.1 68414.m02897 phosphoglucomutase, cytoplasmic, putative / glucose phosphomutase, putative strong similarity to SP|P93805 Phosphoglucomutase, cytoplasmic 2 (EC 5.4.2.2) (Glucose phosphomutase 2) (PGM 2) {Zea mays}; contains InterPro accession IPR006352: Phosphoglucosamine mutase Length = 583 Score = 27.5 bits (58), Expect = 2.7 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = +2 Query: 89 IRLYIETYENGRDKQKTSREKTE 157 IRLYIE YE +D KT RE E Sbjct: 535 IRLYIEQYE--KDASKTGRESQE 555 >At5g53500.1 68418.m06649 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 654 Score = 27.1 bits (57), Expect = 3.5 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = +1 Query: 13 LLITRAVPPCTVEGYRRDREAACSFYPP-VHRDLRK 117 +L+ P T E +R+ ++AC +PP V R + K Sbjct: 284 VLVNEEKPKKTTESFRKTSDSACVVFPPKVFRIMEK 319 >At1g71360.1 68414.m08237 expressed protein low similarity to PIR|JC7185 chromosome 1 C1orf9 protein [Homo sapiens] Length = 459 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +3 Query: 156 KPGDLEDLKQELDIDYHKVTPEELYQRFKRTRKMALVMQK 275 K DLE K+E +++ ++ E + +R + T+K A+ M+K Sbjct: 332 KEMDLEASKREKEVETMRLEVEGMKEREENTKKEAMEMRK 371 >At2g36580.1 68415.m04486 pyruvate kinase, putative similar to pyruvate kinase, cytosolic isozyme [Glycine max] SWISS-PROT:Q42806 Length = 527 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 192 DIDYHKVTPEELYQRFKRTRKMALVM 269 D DYH+ T E L K T+K+ VM Sbjct: 65 DADYHQETLENLKIAVKSTKKLCAVM 90 >At5g64320.1 68418.m08079 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 730 Score = 25.8 bits (54), Expect = 8.1 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 120 GETSRKPPAKKRKPGDLEDLKQELDIDYHKVTPEELYQ 233 G S K KP DL+ L+ +HK+TP +LY+ Sbjct: 50 GTDSANEWEKLLKPFDLDSLRNS----FHKITPFQLYK 83 >At4g28715.1 68417.m04107 myosin heavy chain, putative similar to myosin [Arabidopsis thaliana] gi|499047|emb|CAA84066 Length = 639 Score = 25.8 bits (54), Expect = 8.1 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +3 Query: 84 LLSACT*RLTK-MGETSRKPPAKKRKPGDLEDLKQELDIDYHKVTPEELYQRFKRTRKMA 260 +L A +L K + E + K +KR D+E+ K + + EE+ +FK T+ + Sbjct: 15 VLEAAKSKLEKQVEELTWKLQLEKRMRTDMEESKTQENAKLRSAL-EEMQLQFKETKALH 73 Query: 261 LVMQKRKRT*KETAPML 311 L + + ET P+L Sbjct: 74 LQEVEAAKKMAETVPVL 90 >At3g07730.1 68416.m00933 expressed protein Length = 473 Score = 25.8 bits (54), Expect = 8.1 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +3 Query: 129 SRKPPAKKRKPGDLEDLKQELDIDYHKVTPEELYQRFKRTRKMA 260 +R +KR+ +LE K D+ + E++ QR + RK++ Sbjct: 125 NRVAERRKRRIAELEAAKTSRDVPSLETQQEDIQQRDNKVRKLS 168 >At1g56290.1 68414.m06471 CwfJ-like family protein contains Pfam profiles PF04677: Protein similar to CwfJ N terminus 1, PF04676: Protein similar to CwfJ N terminus 2 Length = 692 Score = 25.8 bits (54), Expect = 8.1 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 3/41 (7%) Frame = +3 Query: 114 KMGETSRKPPAKKRKP---GDLEDLKQELDIDYHKVTPEEL 227 KMG PP +K P D+ED +E + KV P EL Sbjct: 77 KMGLDWMLPPTRKADPNPASDVEDKFEESAPEVTKVNPREL 117 >At1g50460.1 68414.m05656 hexokinase, putative similar to hexokinase 1 [Spinacia oleracea] Swiss-Prot:Q9SEK3 Length = 498 Score = 25.8 bits (54), Expect = 8.1 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 4/51 (7%) Frame = +2 Query: 29 QSHPAPLRDTDETERRLVPFIRL----YIETYENGRDKQKTSREKTETRRF 169 + HP P + T L F+ +IE ENG D Q RE T F Sbjct: 127 ERHPIPSHLMNSTSEVLFNFLAFSLERFIEKEENGSDSQGVRRELAFTFSF 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,303,269 Number of Sequences: 28952 Number of extensions: 166151 Number of successful extensions: 492 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -