BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1079 (452 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g38720.1 68418.m04683 expressed protein predicted protein, Dr... 29 1.9 At3g19890.1 68416.m02518 F-box family protein contains F-box dom... 27 5.9 At2g17550.1 68415.m02031 expressed protein 27 5.9 At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain... 27 7.8 At4g03480.1 68417.m00475 ankyrin repeat family protein contains ... 27 7.8 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 27 7.8 >At5g38720.1 68418.m04683 expressed protein predicted protein, Drosophila melanogaster Length = 306 Score = 28.7 bits (61), Expect = 1.9 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +3 Query: 72 RNTRMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKFK 251 + TR N + +T+G + +K N VEL +D L S+ K K + Sbjct: 2 KETRKLKKSNLPK-EETVGKKIQRKK--NEKVSNVELSEDPQAAQLQAKSSEKPNRKKIQ 58 Query: 252 PGEEFEEDRADG 287 G+E + ADG Sbjct: 59 KGKEIKSSPADG 70 >At3g19890.1 68416.m02518 F-box family protein contains F-box domain Pfam:PF00646 Length = 410 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +3 Query: 174 VELRKDGDEYNLVTSSTFKTTEMKFKPGEEFEEDRADGAKV 296 VE+RKD LV SS++ + K EE EED+ K+ Sbjct: 354 VEVRKDVYRSALVCSSSYVPSLEKINQIEEEEEDKCKSIKM 394 >At2g17550.1 68415.m02031 expressed protein Length = 765 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/85 (18%), Positives = 33/85 (38%) Frame = +3 Query: 90 SSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTEMKFKPGEEFE 269 + + F + + + G + + N R G ++ L + T T + +PG + Sbjct: 178 ADKRFKDCSRIVDSGCVVARDENKERLFTRTRSFGRDFTLKSDRTAPTRIVVLRPGLQRA 237 Query: 270 EDRADGAKVKSVCTFEGNTLKQVQK 344 D D S T EG+ +++ Sbjct: 238 YDYEDSLTTSSGTTMEGSRGSSIEE 262 >At5g09620.1 68418.m01113 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein predicted proteins, Arabidopsis thaliana and Drosophila melanogaster contains Pfam profile PF00564: PB1 domain Length = 531 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/52 (25%), Positives = 30/52 (57%) Frame = +3 Query: 219 STFKTTEMKFKPGEEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEVTYV 374 S+ ++ +++F+ +E+ + KVK +C++ G ++Q P ++TYV Sbjct: 15 SSPRSRDVEFENPSPWEDQQQQNYKVKLMCSYGG----KIQPRPHDNQLTYV 62 >At4g03480.1 68417.m00475 ankyrin repeat family protein contains ankyrin repeats, Pfam domain PF00023 Length = 617 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 299 IRMHIRRQYPQASPEGPRRS*SHLRQGIRP 388 +R H+ R P+ASP P S S+ R + P Sbjct: 2 VRSHLLRATPEASPLKPASSPSNCRLSLSP 31 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 26.6 bits (56), Expect = 7.8 Identities = 20/78 (25%), Positives = 30/78 (38%), Gaps = 1/78 (1%) Frame = +3 Query: 189 DGDEYNLVTSSTFKTTEM-KFKPGEEFEEDRADGAKVKSVCTFEGNTLKQVQKAPDGLEV 365 DG E F E+ + P E D D + CTF+G +K D L + Sbjct: 156 DGSEKQYDILPDFSPAEVAELWPAFSGEHDNMDAQSLVK-CTFQGGRCSNEEKPVDRLLI 214 Query: 366 TYVREFGPEEMKAVMTAK 419 T + E +++A K Sbjct: 215 TLMSECIESDVQAQSVVK 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,396,312 Number of Sequences: 28952 Number of extensions: 186764 Number of successful extensions: 577 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -