BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1078 (540 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 27 1.8 SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosacchar... 25 7.2 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 27.1 bits (57), Expect = 1.8 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 7/64 (10%) Frame = +3 Query: 3 DKEALKKQIENMKY--QASMDRWP-LSRSIAAMREYVEE----NEKNDPLIHAPDKKNNP 161 + EA++K++EN KY Q S DR + + A ++ +E N+ +I D++ + Sbjct: 676 EMEAIRKELENSKYQQQLSTDRLTNANNDVEAFKKEAKELRSINQNLQDIISRQDQRASK 735 Query: 162 WAEK 173 +AE+ Sbjct: 736 FAEE 739 >SPAC8F11.07c |cdc24||DNA replication protein Cdc24|Schizosaccharomyces pombe|chr 1|||Manual Length = 501 Score = 25.0 bits (52), Expect = 7.2 Identities = 11/33 (33%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +3 Query: 6 KEALKKQ-IENMKYQASMDRWPLSRSIAAMREY 101 KE L+ + +E K A D W ++++I+ ++EY Sbjct: 11 KEDLENRLVEKSKQPAFTDYWLINKTISLLKEY 43 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,773,570 Number of Sequences: 5004 Number of extensions: 30037 Number of successful extensions: 76 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 76 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 221892220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -