BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1078 (540 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 2.8 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 8.7 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 8.7 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 2.8 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 15 LKKQIENMKYQASMDRWPLSRSIAAMREYVEENEKNDPLIH 137 + +E MKY+ ++D + + A R Y+ + E IH Sbjct: 885 IDSMLERMKYEKTIDIYGHVTCLRAHRNYMVQTEDQYIFIH 925 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 265 NLRAILKKKSGKMQRLGILSIAQGL 339 N RA +KK S + L + +AQGL Sbjct: 548 NKRAKIKKSSSEKNPLALQLMAQGL 572 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 265 NLRAILKKKSGKMQRLGILSIAQGL 339 N RA +KK S + L + +AQGL Sbjct: 548 NKRAKIKKSSSEKNPLALQLMAQGL 572 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 437,569 Number of Sequences: 2352 Number of extensions: 7268 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -