BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1071 (425 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0616 - 26638438-26638638,26638890-26638971,26639054-266391... 27 6.3 01_01_0770 - 5968042-5968281,5968799-5969156,5970975-5971384 27 6.3 >04_04_0616 - 26638438-26638638,26638890-26638971,26639054-26639141, 26639222-26639278,26641334-26641526 Length = 206 Score = 27.1 bits (57), Expect = 6.3 Identities = 15/28 (53%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = +2 Query: 128 AMPVAEEKDVV--PAQPILEVAPKIDDS 205 A VAEEK V+ PA P E P +DDS Sbjct: 30 AKDVAEEKAVIPAPAPPAEEEKPPVDDS 57 >01_01_0770 - 5968042-5968281,5968799-5969156,5970975-5971384 Length = 335 Score = 27.1 bits (57), Expect = 6.3 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 50 KRRRVTGSIFKMKVLLLCIAFAAVSLAMPVAEEKDVVPAQPILEV 184 KR G + ++ LLLC+A AA + A+P A P P+ E+ Sbjct: 96 KRIGSAGDLGWIEYLLLCLAPAAAAAALPCAATSPTPPC-PLREL 139 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,236,328 Number of Sequences: 37544 Number of extensions: 120224 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 265 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 790518168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -