BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1064 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 7.3 Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical pr... 28 7.3 Z70037-3|CAC42352.1| 902|Caenorhabditis elegans Hypothetical pr... 27 9.7 D84668-1|BAA86913.1| 902|Caenorhabditis elegans CLH-1 protein. 27 9.7 >Z54218-4|CAA90958.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 638 KLQDVQKIKINVDIKLGLLLQQDQKMMYLSFD 543 KLQD+QK+K +VD+ + L +D+ + + D Sbjct: 822 KLQDIQKVKQDVDVSIFEELGEDETCLEVRAD 853 >Z49910-9|CAA90125.1| 1367|Caenorhabditis elegans Hypothetical protein F44G4.8 protein. Length = 1367 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -3 Query: 638 KLQDVQKIKINVDIKLGLLLQQDQKMMYLSFD 543 KLQD+QK+K +VD+ + L +D+ + + D Sbjct: 822 KLQDIQKVKQDVDVSIFEELGEDETCLEVRAD 853 >Z70037-3|CAC42352.1| 902|Caenorhabditis elegans Hypothetical protein T27D12.2b protein. Length = 902 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 264 STILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 133 S I INN+R G + N GNA+ +I G P P Sbjct: 698 SEIFSTINNLRRGSLAANGAHMSSGNALMTDRNISGNTLLPQSP 741 >D84668-1|BAA86913.1| 902|Caenorhabditis elegans CLH-1 protein. Length = 902 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = -2 Query: 264 STILLEINNIREGGRSQNLILFIRGNAISGAPSIRGTNQFPNPP 133 S I INN+R G + N GNA+ +I G P P Sbjct: 698 SEIFSTINNLRRGSLAANGAHMSSGNALMTDRNISGNTLLPQSP 741 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,679,184 Number of Sequences: 27780 Number of extensions: 214548 Number of successful extensions: 449 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 449 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -