BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1061 (501 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-tran... 23 4.4 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 23 7.7 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 23 7.7 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 23 7.7 >AY063776-1|AAL59658.1| 224|Anopheles gambiae glutathione S-transferase E1 protein. Length = 224 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -3 Query: 406 VALFGRHPEVGGSGVEYHLERLRRRADT 323 +A+FGR PE+ +EY + R D+ Sbjct: 120 LAIFGRKPEIPEDRIEYVRKAYRLLEDS 147 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.6 bits (46), Expect = 7.7 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDT-----GSSNLWVP----SKKCHYTNI 418 ++ GV++ TPP S + DT + +W P S+ C Y N+ Sbjct: 214 KWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINV 260 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.6 bits (46), Expect = 7.7 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDT-----GSSNLWVP----SKKCHYTNI 418 ++ GV++ TPP S + DT + +W P S+ C Y N+ Sbjct: 214 KWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINV 260 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 22.6 bits (46), Expect = 7.7 Identities = 14/47 (29%), Positives = 23/47 (48%), Gaps = 9/47 (19%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDT-----GSSNLWVP----SKKCHYTNI 418 ++ GV++ TPP S + DT + +W P S+ C Y N+ Sbjct: 100 KWTGVLNTTTPPNSCVQIVDTVFGDFPGATMWNPNTPLSEDCLYINV 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 526,724 Number of Sequences: 2352 Number of extensions: 10757 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -