BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1061 (501 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 25 0.44 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 25 0.59 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 0.77 EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-a... 24 0.77 AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 23 2.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 5.5 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 7.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 7.2 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 9.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 9.5 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 25.0 bits (52), Expect = 0.44 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = -2 Query: 452 CGCRTCCAANKRCWCSGTFWKAPRGWRIRCRIPP*TTAAAC 330 C C+TC + K C+ P + + R+PP T C Sbjct: 435 CECKTCNSKTKCCFAQDD-GLCPYTLKHKIRVPPGTPIYEC 474 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.6 bits (51), Expect = 0.59 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 374 SNLWVPSKKCHYTNIACL---LHNKYDSRKSKTYVAN 475 SN + P CH +IAC + K D R KT N Sbjct: 354 SNGYTPVLDCHTAHIACKFADIKEKCDRRNGKTTEEN 390 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 0.77 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 374 SNLWVPSKKCHYTNIACL---LHNKYDSRKSKTYVAN 475 SN + P CH +IAC + K D R KT N Sbjct: 354 SNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEEN 390 >EF013227-1|ABK54581.1| 119|Apis mellifera elongation factor 1-alpha protein. Length = 119 Score = 24.2 bits (50), Expect = 0.77 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +2 Query: 374 SNLWVPSKKCHYTNIACL---LHNKYDSRKSKTYVAN 475 SN + P CH +IAC + K D R KT N Sbjct: 65 SNGYTPVLDCHTAHIACKFAEIKEKCDRRTGKTTEEN 101 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 22.6 bits (46), Expect = 2.4 Identities = 8/36 (22%), Positives = 20/36 (55%) Frame = +2 Query: 95 RLLKTTMGKISLFFLALIASSVMALYRVPLHRMKTA 202 R+++ +GK+ + + + V++LY P+ + A Sbjct: 76 RVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAA 111 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 5.5 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +2 Query: 116 GKISLFFLALIASSVMALYRVPLHRMKTARTHFHEVGTELELLRLKYDVTGPSPEPL 286 GK+++ + S + ++ V L + VG +E+ K DVTG P PL Sbjct: 289 GKLNVNEFYMAFSKLYSVSVVSLDKSLEVNHISARVGDNVEI---KCDVTGTPPPPL 342 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 107 TNYKKLQYYNIINIEQIP 124 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 7.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 287 SNYLDAQYYGVISIGTPP 340 +NY QYY +I+I P Sbjct: 103 TNYKKLQYYNIINIEQIP 120 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/31 (22%), Positives = 17/31 (54%) Frame = +3 Query: 42 NKSINNNSQFLISKSPSCGF*KQQWERYLYF 134 NK+I+NN+ + + + + + + LY+ Sbjct: 87 NKTIHNNNNYKYNYNNKYNYNNNNYNKKLYY 117 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 367 GVEYHLERLRRRADTDHSVVL 305 G E+HL+ + + T +SVV+ Sbjct: 1037 GKEHHLQIMNLKTYTQYSVVV 1057 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,803 Number of Sequences: 438 Number of extensions: 3464 Number of successful extensions: 16 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -