BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1061 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g11910.1 68414.m01374 aspartyl protease family protein contai... 109 8e-25 At4g04460.1 68417.m00648 aspartyl protease family protein contai... 105 2e-23 At1g62290.1 68414.m07027 aspartyl protease family protein contai... 104 4e-23 At1g69100.1 68414.m07907 aspartyl protease family protein contai... 65 2e-11 At4g22050.1 68417.m03189 aspartyl protease family protein contai... 64 5e-11 At3g42550.1 68416.m04414 aspartyl protease family protein weak s... 48 4e-06 At3g51350.1 68416.m05622 aspartyl protease family protein contai... 43 1e-04 At1g31450.1 68414.m03851 aspartyl protease family protein contai... 43 1e-04 At5g45120.1 68418.m05539 aspartyl protease family protein contai... 42 2e-04 At1g08210.1 68414.m00907 aspartyl protease family protein contai... 42 2e-04 At2g35615.1 68415.m04367 aspartyl protease family protein contai... 41 5e-04 At5g10080.1 68418.m01168 aspartyl protease family protein contai... 40 7e-04 At3g12700.1 68416.m01587 aspartyl protease family protein contai... 40 7e-04 At2g36670.2 68415.m04498 aspartyl protease family protein contai... 40 0.001 At5g36260.1 68418.m04374 aspartyl protease family protein contai... 40 0.001 At5g22850.1 68418.m02671 aspartyl protease family protein contai... 40 0.001 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 39 0.002 At2g36670.1 68415.m04497 aspartyl protease family protein contai... 39 0.002 At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protei... 39 0.002 At3g52500.1 68416.m05773 aspartyl protease family protein contai... 38 0.005 At1g65240.1 68414.m07396 aspartyl protease family protein contai... 38 0.005 At1g05840.1 68414.m00611 aspartyl protease family protein contai... 38 0.005 At5g33340.1 68418.m03957 aspartyl protease family protein contai... 37 0.007 At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protei... 37 0.007 At1g64830.1 68414.m07350 aspartyl protease family protein contai... 37 0.007 At5g43100.1 68418.m05261 aspartyl protease family protein low si... 36 0.012 At3g51360.1 68416.m05624 aspartyl protease family protein contai... 36 0.012 At2g28010.1 68415.m03394 aspartyl protease family protein contai... 36 0.012 At1g66180.1 68414.m07512 aspartyl protease family protein contai... 36 0.012 At1g01300.1 68414.m00046 aspartyl protease family protein contai... 36 0.012 At3g59080.1 68416.m06586 aspartyl protease family protein contai... 36 0.015 At2g28040.1 68415.m03399 aspartyl protease family protein contai... 36 0.015 At3g50050.1 68416.m05472 aspartyl protease family protein contai... 36 0.020 At3g02740.1 68416.m00266 aspartyl protease family protein contai... 36 0.020 At2g42980.1 68415.m05332 aspartyl protease family protein contai... 36 0.020 At5g02190.1 68418.m00140 aspartyl protease family protein contai... 35 0.027 At3g61820.1 68416.m06939 aspartyl protease family protein contai... 35 0.027 At4g35880.1 68417.m05095 aspartyl protease family protein contai... 35 0.035 At1g44130.1 68414.m05097 nucellin protein, putative similar to n... 35 0.035 At2g17760.1 68415.m02057 aspartyl protease family protein contai... 34 0.047 At5g10760.1 68418.m01250 aspartyl protease family protein contai... 34 0.062 At3g51330.1 68416.m05619 aspartyl protease family protein contai... 34 0.062 At3g20015.1 68416.m02532 aspartyl protease family protein contai... 33 0.082 At3g18490.1 68416.m02350 aspartyl protease family protein contai... 33 0.082 At1g77480.2 68414.m09023 nucellin protein, putative similar to n... 33 0.082 At1g77480.1 68414.m09022 nucellin protein, putative similar to n... 33 0.082 At2g39710.1 68415.m04872 aspartyl protease family protein contai... 33 0.14 At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protei... 33 0.14 At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protei... 32 0.19 At2g28220.1 68415.m03426 aspartyl protease family protein contai... 31 0.33 At5g37540.1 68418.m04521 aspartyl protease family protein weak s... 31 0.44 At2g28030.1 68415.m03397 aspartyl protease family protein contai... 31 0.44 At2g03200.1 68415.m00273 aspartyl protease family protein contai... 31 0.44 At4g33490.1 68417.m04756 nucellin protein, putative similar to n... 31 0.58 At3g54400.1 68416.m06015 aspartyl protease family protein contai... 31 0.58 At5g07030.1 68418.m00796 aspartyl protease family protein contai... 30 0.76 At4g30030.1 68417.m04273 aspartyl protease family protein contai... 29 1.8 At1g52190.1 68414.m05889 proton-dependent oligopeptide transport... 29 2.3 At1g03220.1 68414.m00300 extracellular dermal glycoprotein, puta... 29 2.3 At1g25510.1 68414.m03168 aspartyl protease family protein contai... 28 3.1 At4g30040.1 68417.m04274 aspartyl protease family contains Pfam ... 27 5.4 At2g02630.1 68415.m00202 DC1 domain-containing protein contains ... 27 7.1 At5g59400.2 68418.m07444 expressed protein predicted protein, Ar... 27 9.4 At5g59400.1 68418.m07443 expressed protein predicted protein, Ar... 27 9.4 At5g19120.1 68418.m02275 expressed protein low similarity to ext... 27 9.4 At4g16563.1 68417.m02506 aspartyl protease family protein contai... 27 9.4 At3g45630.1 68416.m04928 RNA recognition motif (RRM)-containing ... 27 9.4 At2g29720.1 68415.m03612 monooxygenase family protein nearly ide... 27 9.4 At1g79370.1 68414.m09249 cytochrome P450 family protein similar ... 27 9.4 >At1g11910.1 68414.m01374 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 506 Score = 109 bits (263), Expect = 8e-25 Identities = 51/72 (70%), Positives = 55/72 (76%) Frame = +2 Query: 284 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 463 L NYLDAQYYG I+IGTPPQ F VVFDTGSSNLWVPS KC Y ++ACLLH KY S +S T Sbjct: 74 LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKC-YFSLACLLHPKYKSSRSST 132 Query: 464 YVANGTQFAIQY 499 Y NG AI Y Sbjct: 133 YEKNGKAAAIHY 144 >At4g04460.1 68417.m00648 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 508 Score = 105 bits (251), Expect = 2e-23 Identities = 45/73 (61%), Positives = 56/73 (76%) Frame = +2 Query: 281 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 460 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLW+PS KC Y ++AC H+KY + +S Sbjct: 78 PLKNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKC-YLSVACYFHSKYKASQSS 136 Query: 461 TYVANGTQFAIQY 499 +Y NG +I+Y Sbjct: 137 SYRKNGKPASIRY 149 >At1g62290.1 68414.m07027 aspartyl protease family protein contains Pfam profiles: PF00026 eukaryotic aspartyl protease, PF03489 surfactant protein B, PF05184 saposin-like type B, region 1 Length = 513 Score = 104 bits (249), Expect = 4e-23 Identities = 46/73 (63%), Positives = 55/73 (75%) Frame = +2 Query: 281 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 460 PL NYLDAQYYG I+IGTPPQ F V+FDTGSSNLWVPS KC + +++C H KY S +S Sbjct: 80 PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFF-SLSCYFHAKYKSSRSS 138 Query: 461 TYVANGTQFAIQY 499 TY +G + AI Y Sbjct: 139 TYKKSGKRAAIHY 151 >At1g69100.1 68414.m07907 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 343 Score = 65.3 bits (152), Expect = 2e-11 Identities = 35/77 (45%), Positives = 46/77 (59%) Frame = +2 Query: 233 LELLRLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYT 412 + L R +V G S L N+ +YG IS+G+PPQ F VVFDTGS++LWVPSK+ + Sbjct: 22 ISLKRHTLNVGGTSFGGLKNFDGVVFYGEISVGSPPQKFNVVFDTGSTDLWVPSKE--WP 79 Query: 413 NIACLLHNKYDSRKSKT 463 H K+D SKT Sbjct: 80 EETDHKHPKFDKDASKT 96 >At4g22050.1 68417.m03189 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 354 Score = 64.1 bits (149), Expect = 5e-11 Identities = 33/72 (45%), Positives = 45/72 (62%) Frame = +2 Query: 284 LSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 463 L N D YYG I IG P Q+F V+FDTGSS+LWVPS+ ++ N+Y S S+T Sbjct: 38 LKNVKDFLYYGKIQIGNPGQTFTVLFDTGSSSLWVPSE--NWLAKTENPRNRYISSASRT 95 Query: 464 YVANGTQFAIQY 499 + NGT+ ++Y Sbjct: 96 FKENGTKAELKY 107 >At3g42550.1 68416.m04414 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 356 Score = 48.0 bits (109), Expect = 4e-06 Identities = 22/47 (46%), Positives = 26/47 (55%) Frame = +2 Query: 296 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN 436 L A YY + IGTPP+ VV DTGS +WV C + C LHN Sbjct: 74 LSALYYTTVQIGTPPRELDVVIDTGSDLVWVSCNSC----VGCPLHN 116 >At3g51350.1 68416.m05622 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 43.2 bits (97), Expect = 1e-04 Identities = 17/32 (53%), Positives = 21/32 (65%) Frame = +2 Query: 296 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 391 L + YY +S+GTPP SF V DTGS W+P Sbjct: 98 LGSLYYANVSVGTPPSSFLVALDTGSDLFWLP 129 >At1g31450.1 68414.m03851 aspartyl protease family protein contains eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 445 Score = 43.2 bits (97), Expect = 1e-04 Identities = 23/56 (41%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 466 +Y+ ISIGTPP + DTGS WV K C C N +D +KS TY Sbjct: 84 EYFMSISIGTPPSKVFAIADTGSDLTWVQCKPCQ----QCYKQNSPLFDKKKSSTY 135 >At5g45120.1 68418.m05539 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 491 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/49 (42%), Positives = 26/49 (53%) Frame = +2 Query: 278 EPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 424 EPL D Y ++IGTPPQ+ +V DTGS WVP + I C Sbjct: 74 EPLREVRDG-YLITLNIGTPPQAVQVYLDTGSDLTWVPCGNLSFDCIEC 121 >At1g08210.1 68414.m00907 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) {Nicotiana tabacum} Length = 492 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +2 Query: 293 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 406 +L YY + +GTPP+ F V DTGS LWV C+ Sbjct: 79 FLVGLYYTKVKLGTPPREFNVQIDTGSDVLWVSCTSCN 116 >At2g35615.1 68415.m04367 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 447 Score = 40.7 bits (91), Expect = 5e-04 Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Frame = +2 Query: 299 DAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 466 D +++ I+IGTPP + DTGS WV K C C N +D +KS TY Sbjct: 82 DGEFFMSITIGTPPIKVFAIADTGSDLTWVQCKPCQ----QCYKENGPIFDKKKSSTY 135 >At5g10080.1 68418.m01168 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 528 Score = 40.3 bits (90), Expect = 7e-04 Identities = 22/51 (43%), Positives = 27/51 (52%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSK 460 +Y I IGTP SF V DTGS+ LW+P C+ A L Y S +K Sbjct: 100 HYTWIDIGTPSVSFLVALDTGSNLLWIP---CNCVQCAPLTSTYYSSLATK 147 >At3g12700.1 68416.m01587 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 461 Score = 40.3 bits (90), Expect = 7e-04 Identities = 19/40 (47%), Positives = 24/40 (60%) Frame = +2 Query: 290 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHY 409 +Y AQY+ I +GTP + F+VV DTGS WV C Y Sbjct: 100 DYGTAQYFTEIRVGTPAKKFRVVVDTGSELTWV---NCRY 136 >At2g36670.2 68415.m04498 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 507 Score = 39.9 bits (89), Expect = 0.001 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 293 YLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 YL Y+ + +G+PP F V DTGS LWV C Sbjct: 95 YLVGLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 131 >At5g36260.1 68418.m04374 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 482 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKT 463 Y+ I +G+PP+ + V DTGS LWV P KC + + YDS+ S T Sbjct: 78 YFTKIKLGSPPKEYYVQVDTGSDILWVNCAPCPKCPVKTDLGIPLSLYDSKTSST 132 >At5g22850.1 68418.m02671 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 493 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/33 (48%), Positives = 20/33 (60%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 406 YY + +GTPP+ F V DTGS LWV C+ Sbjct: 81 YYTKLRLGTPPRDFYVQVDTGSDVLWVSCASCN 113 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 38.7 bits (86), Expect = 0.002 Identities = 23/62 (37%), Positives = 33/62 (53%) Frame = +2 Query: 290 NYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 469 N+L +Y +S+GTP F V DTGS W+P C T C +H+ D+R S++ Sbjct: 85 NFLGFLHYANVSLGTPATWFLVALDTGSDLFWLPC-NCGTT---C-IHDLKDARFSESVP 139 Query: 470 AN 475 N Sbjct: 140 LN 141 >At2g36670.1 68415.m04497 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 512 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +2 Query: 254 YDVTGPS-PEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 + V G S P + + + Y+ + +G+PP F V DTGS LWV C Sbjct: 86 FPVQGSSDPYLVGSKMTMLYFTKVKLGSPPTEFNVQIDTGSDILWVTCSSC 136 >At2g23945.1 68415.m02859 chloroplast nucleoid DNA-binding protein-related contains weak similarity to GP|2541876|dbj|BAA22813.1||D26015 CND41, chloroplast nucleoid DNA binding protein {Nicotiana tabacum} Length = 458 Score = 38.7 bits (86), Expect = 0.002 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +2 Query: 323 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYV 469 S+G PP + DTGSS LW+ + C + + ++H ++ S T+V Sbjct: 101 SVGQPPVPQLTIMDTGSSLLWIQCQPCKHCSSDHMIHPVFNPALSSTFV 149 >At3g52500.1 68416.m05773 aspartyl protease family protein contains Pfam PF00026: eukaryotic aspartyl protease Length = 469 Score = 37.5 bits (83), Expect = 0.005 Identities = 18/37 (48%), Positives = 22/37 (59%) Frame = +2 Query: 281 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVP 391 PLS Y +S GTP Q+ VFDTGSS +W+P Sbjct: 81 PLSAKSYGGYSVSLSFGTPSQTIPFVFDTGSSLVWLP 117 >At1g65240.1 68414.m07396 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 475 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 Y+ I +G+PP+ + V DTGS LW+ K C Sbjct: 74 YFTKIKLGSPPKEYHVQVDTGSDILWINCKPC 105 >At1g05840.1 68414.m00611 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 485 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 YY I IGTP +S+ V DTGS +WV +C Sbjct: 80 YYAKIGIGTPAKSYYVQVDTGSDIMWVNCIQC 111 >At5g33340.1 68418.m03957 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 437 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/68 (33%), Positives = 30/68 (44%), Gaps = 2/68 (2%) Frame = +2 Query: 269 PSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLLHNKY 442 P P+ +Y +SIGTPP + DTGS LW C YT + L + Sbjct: 77 PQPQIDLTSNSGEYLMNVSIGTPPFPIMAIADTGSDLLWTQCAPCDDCYTQVDPL----F 132 Query: 443 DSRKSKTY 466 D + S TY Sbjct: 133 DPKTSSTY 140 >At3g25700.1 68416.m03198 chloroplast nucleoid DNA-binding protein-related contains weak similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 452 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 QY+ + IG PPQS ++ DTGS +WV C Sbjct: 83 QYFVDLRIGQPPQSLLLIADTGSDLVWVKCSAC 115 >At1g64830.1 68414.m07350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 431 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/72 (31%), Positives = 32/72 (44%), Gaps = 2/72 (2%) Frame = +2 Query: 257 DVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH--YTNIACLL 430 D + SP+ +Y ISIGTPP + DTGS +W C Y + L Sbjct: 69 DASPNSPQSFITSNRGEYLMNISIGTPPVPILAIADTGSDLIWTQCNPCEDCYQQTSPL- 127 Query: 431 HNKYDSRKSKTY 466 +D ++S TY Sbjct: 128 ---FDPKESSTY 136 >At5g43100.1 68418.m05261 aspartyl protease family protein low similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 631 Score = 36.3 bits (80), Expect = 0.012 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 326 IGTPPQSFKVVFDTGSSNLWVPSKKC 403 IGTPPQ F ++ DTGS+ +VP C Sbjct: 82 IGTPPQEFALIVDTGSTVTYVPCSTC 107 >At3g51360.1 68416.m05624 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 488 Score = 36.3 bits (80), Expect = 0.012 Identities = 18/53 (33%), Positives = 28/53 (52%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 466 +Y ++IGTP Q F V DTGS W+P C+ T + + ++ + K Y Sbjct: 89 HYANVTIGTPAQWFLVALDTGSDLFWLPC-NCNSTCVRSMETDQGERIKLNIY 140 >At2g28010.1 68415.m03394 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 396 Score = 36.3 bits (80), Expect = 0.012 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 3/88 (3%) Frame = +2 Query: 245 RLKYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLW---VPSKKCHYTN 415 R+ +G SP + + ++ Y + +GTPP + + DTGS W +P C+ N Sbjct: 44 RVSNTQSGSSPYANTVFDNSVYLMKLQVGTPPFEIQAIIDTGSEITWTQCLPCVHCYEQN 103 Query: 416 IACLLHNKYDSRKSKTYVANGTQFAIQY 499 +K + K K + + + Y Sbjct: 104 APIFDPSKSSTFKEKRCDGHSCPYEVDY 131 >At1g66180.1 68414.m07512 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease profile; similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 430 Score = 36.3 bits (80), Expect = 0.012 Identities = 34/119 (28%), Positives = 52/119 (43%), Gaps = 7/119 (5%) Frame = +2 Query: 131 FFLALIASSVMALYRVPLHRMK-TARTHFHEVGTELELLRLKYDVTGPSPE-PLSNYLDA 304 FFL ++ S +PL + + T+ H T L L K PSP P N+ Sbjct: 12 FFLNYVSLSTSLSLHLPLTSLPISTTTNSHRFTTSL--LSRK----NPSPSSPPYNFRSR 65 Query: 305 QYYGV-----ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 466 Y + + IGTPPQ+ ++V DTGS W+ +CH + +D S ++ Sbjct: 66 FKYSMALIISLPIGTPPQAQQMVLDTGSQLSWI---QCHRKKLPPKPKTSFDPSLSSSF 121 >At1g01300.1 68414.m00046 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 485 Score = 36.3 bits (80), Expect = 0.012 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 3/57 (5%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTY 466 +Y+ + +GTP + +V DTGS +W+ P ++C+ + +D RKSKTY Sbjct: 141 EYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPI-----FDPRKSKTY 192 >At3g59080.1 68416.m06586 aspartyl protease family protein contains similarity to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum]; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 535 Score = 35.9 bits (79), Expect = 0.015 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 2/56 (3%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNK--YDSRKSKTY 466 +Y+ + +G+PP+ F ++ DTGS W+ C+ C N YD + S +Y Sbjct: 169 EYFMDVLVGSPPKHFSLILDTGSDLNWIQCLPCY----DCFQQNGAFYDPKASASY 220 >At2g28040.1 68415.m03399 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 395 Score = 35.9 bits (79), Expect = 0.015 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC-HYTNIACLLHNKYDSRKSKTY 466 +Y + IGTPP + V DTGS ++W C H N + +D KS T+ Sbjct: 64 EYLMKLQIGTPPFEIEAVLDTGSEHIWTQCLPCVHCYNQTAPI---FDPSKSSTF 115 >At3g50050.1 68416.m05472 aspartyl protease family protein contains Pfam PF00026: Eukaryotic aspartyl protease Length = 632 Score = 35.5 bits (78), Expect = 0.020 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = +2 Query: 296 LDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHN--KYDSRKSKTY 466 ++ Y + IGTPPQ F ++ D+GS+ +VP C C H K+ S TY Sbjct: 89 INGYYTTRLWIGTPPQMFALIVDSGSTVTYVPCSDCE----QCGKHQDPKFQPEMSSTY 143 >At3g02740.1 68416.m00266 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 488 Score = 35.5 bits (78), Expect = 0.020 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 Y+ I +GTP + F V DTGS LWV C Sbjct: 85 YFAKIGLGTPSRDFHVQVDTGSDILWVNCAGC 116 >At2g42980.1 68415.m05332 aspartyl protease family protein contains pfam profile: PF00026 eukaryotic aspartyl protease Length = 527 Score = 35.5 bits (78), Expect = 0.020 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCH 406 +Y+ + +GTPP+ F ++ DTGS W+ C+ Sbjct: 159 EYFMDVLVGTPPKHFSLILDTGSDLNWLQCLPCY 192 >At5g02190.1 68418.m00140 aspartyl protease family protein contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 453 Score = 35.1 bits (77), Expect = 0.027 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 466 +++GTPPQ+ +V DTGS W+ + N N +D +S +Y Sbjct: 77 LTVGTPPQNISMVIDTGSELSWLRCNRSSNPNPV----NNFDPTRSSSY 121 >At3g61820.1 68416.m06939 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 35.1 bits (77), Expect = 0.027 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 3/57 (5%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWV---PSKKCHYTNIACLLHNKYDSRKSKTY 466 +Y+ + +GTP + +V DTGS +W+ P K C+ A +D +KSKT+ Sbjct: 134 EYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAI-----FDPKKSKTF 185 >At4g35880.1 68417.m05095 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 524 Score = 34.7 bits (76), Expect = 0.035 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVP 391 +Y + +GTP F V DTGS WVP Sbjct: 107 HYTTVKLGTPGMRFMVALDTGSDLFWVP 134 >At1g44130.1 68414.m05097 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 405 Score = 34.7 bits (76), Expect = 0.035 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +2 Query: 281 PLS-NYLDAQYYGVI-SIGTPPQSFKVVFDTGSSNLWV 388 PLS N YY V+ IG+PP++F+ DTGS WV Sbjct: 38 PLSGNVFPLGYYSVLMQIGSPPKAFQFDIDTGSDLTWV 75 >At2g17760.1 68415.m02057 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 513 Score = 34.3 bits (75), Expect = 0.047 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTN 415 +Y +++GTP F V DTGS W+P C TN Sbjct: 104 HYANVTVGTPSDWFMVALDTGSDLFWLP---CDCTN 136 >At5g10760.1 68418.m01250 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 464 Score = 33.9 bits (74), Expect = 0.062 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 Y I IGTP +VFDTGS W + C Sbjct: 132 YIVTIGIGTPKHDLSLVFDTGSDLTWTQCEPC 163 >At3g51330.1 68416.m05619 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 529 Score = 33.9 bits (74), Expect = 0.062 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVP 391 +Y +S+GTP F V DTGS W+P Sbjct: 102 HYANVSVGTPATWFLVALDTGSDLFWLP 129 >At3g20015.1 68416.m02532 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 386 Score = 33.5 bits (73), Expect = 0.082 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 +Y+ I +G+PP+ +V D+GS +WV + C Sbjct: 46 EYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPC 78 >At3g18490.1 68416.m02350 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 500 Score = 33.5 bits (73), Expect = 0.082 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 +Y+ I +GTP + +V DTGS W+ + C Sbjct: 161 EYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC 193 >At1g77480.2 68414.m09023 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 432 Score = 33.5 bits (73), Expect = 0.082 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWV 388 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At1g77480.1 68414.m09022 nucellin protein, putative similar to nucellin GB:AAB96882 GI:2290202 [Hordeum vulgare] (nucellin: similar to aspartic protease and its specific expression in nucellar cells during degeneration) Length = 466 Score = 33.5 bits (73), Expect = 0.082 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWV 388 YY +++IG PP+ F + DTGS WV Sbjct: 67 YYVLLNIGNPPKLFDLDIDTGSDLTWV 93 >At2g39710.1 68415.m04872 aspartyl protease family protein contains profile Pfam PF00026: Eukaryotic aspartyl protease; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site.; Length = 442 Score = 32.7 bits (71), Expect = 0.14 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKK 400 +++G PPQ+ +V DTGS W+ KK Sbjct: 69 LAVGDPPQNISMVLDTGSELSWLHCKK 95 >At1g09750.1 68414.m01094 chloroplast nucleoid DNA-binding protein-related contains Pfam profile PF00026: Eukaryotic aspartyl protease;b similar to CND41, chloroplast nucleoid DNA binding protein (GI:2541876) [Nicotiana tabacum] Length = 449 Score = 32.7 bits (71), Expect = 0.14 Identities = 20/65 (30%), Positives = 29/65 (44%), Gaps = 1/65 (1%) Frame = +2 Query: 275 PEPLSNYLDAQYYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSR 451 P N L Y V +GTPPQ +V DT + +W+P C + A +++ Sbjct: 92 PVASGNQLHIGNYVVRAKLGTPPQLMFMVLDTSNDAVWLPCSGCSGCSNA---STSFNTN 148 Query: 452 KSKTY 466 S TY Sbjct: 149 SSSTY 153 >At5g10770.1 68418.m01252 chloroplast nucleoid DNA-binding protein, putative similar to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Pfam profile PF00026: Eukaryotic aspartyl protease Length = 474 Score = 32.3 bits (70), Expect = 0.19 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = +2 Query: 308 YYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 Y + +GTP ++FDTGS W + C Sbjct: 132 YIVTVGLGTPKNDLSLIFDTGSDLTWTQCQPC 163 >At2g28220.1 68415.m03426 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 756 Score = 31.5 bits (68), Expect = 0.33 Identities = 20/67 (29%), Positives = 27/67 (40%) Frame = +2 Query: 266 GPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYD 445 G SP + Y + Y + +GTPP DTGS +W C N +D Sbjct: 407 GASPYADTLYDYSIYLMKLQVGTPPFEIVAEIDTGSDIIWTQCMPC--PNCYSQFAPIFD 464 Query: 446 SRKSKTY 466 KS T+ Sbjct: 465 PSKSSTF 471 Score = 29.1 bits (62), Expect = 1.8 Identities = 15/51 (29%), Positives = 21/51 (41%) Frame = +2 Query: 251 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 K + G SP + + Y + +GTPP DTGS +W C Sbjct: 63 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIAAEIDTGSDLIWTQCMPC 113 >At5g37540.1 68418.m04521 aspartyl protease family protein weak similarity to CND41, chloroplast nucleoid DNA binding protein [Nicotiana tabacum] GI:2541876; contains Prosite PS00141: Eukaryotic and viral aspartyl proteases active site; contains 1 predicted transmembrane domain Length = 442 Score = 31.1 bits (67), Expect = 0.44 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKKCH 406 + IGTP QS ++V DTGS W+ +CH Sbjct: 84 LPIGTPSQSQELVLDTGSQLSWI---QCH 109 >At2g28030.1 68415.m03397 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 392 Score = 31.1 bits (67), Expect = 0.44 Identities = 20/72 (27%), Positives = 29/72 (40%) Frame = +2 Query: 251 KYDVTGPSPEPLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLL 430 K + G SP + + Y + +GTPP + DTGS +W C TN Sbjct: 42 KNQLQGASPYADTLFDYNIYLMKLQVGTPPFEIEAEIDTGSDLIWTQCMPC--TNCYSQY 99 Query: 431 HNKYDSRKSKTY 466 +D S T+ Sbjct: 100 APIFDPSNSSTF 111 >At2g03200.1 68415.m00273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 461 Score = 31.1 bits (67), Expect = 0.44 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 +SIG P + + DTGS +W K C Sbjct: 111 LSIGNPAVKYSAIVDTGSDLIWTQCKPC 138 >At4g33490.1 68417.m04756 nucellin protein, putative similar to nucellin GI:2290202 from [Hordeum vulgare] Length = 425 Score = 30.7 bits (66), Expect = 0.58 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +2 Query: 308 YYGV-ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACL 427 YY V I+IG PP+ + + DTGS W+ +C + CL Sbjct: 59 YYNVTINIGQPPRPYYLDLDTGSDLTWL---QCDAPCVRCL 96 >At3g54400.1 68416.m06015 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 425 Score = 30.7 bits (66), Expect = 0.58 Identities = 15/47 (31%), Positives = 21/47 (44%) Frame = +2 Query: 323 SIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKT 463 +IGTP Q V DT + W+P C + C +D KS + Sbjct: 93 NIGTPAQPMLVALDTSNDAAWIPCSGC----VGCSSSVLFDPSKSSS 135 >At5g07030.1 68418.m00796 aspartyl protease family protein contains Pfam profile:PF00026 eukaryotic aspartyl protease Length = 439 Score = 30.3 bits (65), Expect = 0.76 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 326 IGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTY 466 IGTP Q + DT S W+P C + C + + KS ++ Sbjct: 105 IGTPAQPLLLAMDTSSDVAWIPCSGC----VGCPSNTAFSPAKSTSF 147 >At4g30030.1 68417.m04273 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 424 Score = 29.1 bits (62), Expect = 1.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 302 AQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 A + ISIG PP ++ DTGS W+ C Sbjct: 76 AAFLANISIGNPPVPQLLLIDTGSDLTWIHCLPC 109 >At1g52190.1 68414.m05889 proton-dependent oligopeptide transport (POT) family protein contains Pfam profile: PF00854 POT family Length = 607 Score = 28.7 bits (61), Expect = 2.3 Identities = 14/52 (26%), Positives = 24/52 (46%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSRKSKTYVAN 475 +S+ SF + S + PS+K + N ACL+ N+ + S + N Sbjct: 264 LSLPDHHDSFDCYYHMKDSEIKAPSQKLRFLNKACLISNREEEIGSDGFALN 315 >At1g03220.1 68414.m00300 extracellular dermal glycoprotein, putative / EDGP, putative similar to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741 Length = 433 Score = 28.7 bits (61), Expect = 2.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKK 400 QY VI+ TP VVFD G LWV K Sbjct: 43 QYTTVINQRTPLVPASVVFDLGGRELWVDCDK 74 >At1g25510.1 68414.m03168 aspartyl protease family protein contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 483 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 +Y+ + IG P + +V DTGS W+ C Sbjct: 147 EYFTRVGIGKPAREVYMVLDTGSDVNWLQCTPC 179 >At4g30040.1 68417.m04274 aspartyl protease family contains Pfam domain, PF00026: eukaryotic aspartyl protease Length = 427 Score = 27.5 bits (58), Expect = 5.4 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 320 ISIGTPPQSFKVVFDTGSSNLWVPSKKC 403 ISIG+PP + + DT S LW+ C Sbjct: 89 ISIGSPPITQLLHMDTASDLLWIQCLPC 116 >At2g02630.1 68415.m00202 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 440 Score = 27.1 bits (57), Expect = 7.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = -1 Query: 474 FATYVLDLRLSYLLCSKQAMLV*WH 400 F +Y+ D+ +SY+LCS + + +H Sbjct: 415 FVSYIKDMFISYILCSSKHLKTRYH 439 >At5g59400.2 68418.m07444 expressed protein predicted protein, Arabidopsis thaliana Length = 301 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 241 VEIKIRCDWPFTRTIVKLS*CSVLRSDQYRHA 336 VE+K+R W ++++VK CS+LR Y A Sbjct: 100 VELKLR--WYGSKSVVKYPRCSLLRQSTYADA 129 >At5g59400.1 68418.m07443 expressed protein predicted protein, Arabidopsis thaliana Length = 299 Score = 26.6 bits (56), Expect = 9.4 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 241 VEIKIRCDWPFTRTIVKLS*CSVLRSDQYRHA 336 VE+K+R W ++++VK CS+LR Y A Sbjct: 100 VELKLR--WYGSKSVVKYPRCSLLRQSTYADA 129 >At5g19120.1 68418.m02275 expressed protein low similarity to extracellular dermal glycoprotein EDGP precursor [Daucus carota] GI:285741, SP|P13917 Basic 7S globulin precursor {Glycine max} Length = 386 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +2 Query: 305 QYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTN 415 QY I +G P K+V D S LW H ++ Sbjct: 44 QYLAQIRLGDSPDPVKLVVDLAGSILWFDCSSRHVSS 80 >At4g16563.1 68417.m02506 aspartyl protease family protein contains Pfam profile: PF00026 eukaryotic aspartyl protease Length = 499 Score = 26.6 bits (56), Expect = 9.4 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +2 Query: 281 PLSNYLDAQYYGVISIGTPPQSFKVVFDTGSSNLWVPSKKCHYTNIAC 424 P+S+ D Y +S+G+ + + DTGS +W P + +T I C Sbjct: 76 PISSGSD--YLISLSVGSSSSAVSLYLDTGSDLVWFPCRP--FTCILC 119 >At3g45630.1 68416.m04928 RNA recognition motif (RRM)-containing protein similar to SP|P34909 General negative regulator of transcription subunit 4 {Saccharomyces cerevisiae}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 989 Score = 26.6 bits (56), Expect = 9.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +2 Query: 338 PQSFKVVFDTGSSNLWVPSKKCHYTNIACLLHNKYDSR 451 P K+V D S P++ I+CL+ + Y+SR Sbjct: 380 PLQQKIVLDPESKRTTSPNRDPSSNQISCLVESSYNSR 417 >At2g29720.1 68415.m03612 monooxygenase family protein nearly identical to CTF2B [GI:4164578][Plant Physiol. 119, 364 (1999), PGR99-008] Length = 427 Score = 26.6 bits (56), Expect = 9.4 Identities = 14/39 (35%), Positives = 19/39 (48%) Frame = -2 Query: 317 LRSTEHQDNLTMVRVKGQSHRILISTAPVQCQPHESGFS 201 LRS + +DN V+G R+L+ T Q P FS Sbjct: 123 LRSFKFKDNDQSQEVRGVERRVLLETLASQLPPQTIRFS 161 >At1g79370.1 68414.m09249 cytochrome P450 family protein similar to cytochrome P450 GI:984542 [Sorghum bicolor]; similar to cytochrome P450 GI:6739530 [Manihot esculenta] Length = 546 Score = 26.6 bits (56), Expect = 9.4 Identities = 23/84 (27%), Positives = 35/84 (41%), Gaps = 8/84 (9%) Frame = +2 Query: 236 ELLRLKYDVTGPSPEPLS-NYLDAQYYGVI--SIGTPPQSFKVVFD-----TGSSNLWVP 391 E++R K V P+ S Y+ Y GV+ G K V T + NL + Sbjct: 98 EVVREKDAVFADRPDSYSAEYISGGYNGVVFDEYGERQMKMKKVMSSELMSTKALNLLLK 157 Query: 392 SKKCHYTNIACLLHNKYDSRKSKT 463 + N+ +HN Y+ +SKT Sbjct: 158 VRNLESDNLLAYVHNLYNKDESKT 181 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,790,558 Number of Sequences: 28952 Number of extensions: 222564 Number of successful extensions: 651 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 647 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -