BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1054 (627 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g16750.1 68418.m01961 transducin family protein / WD-40 repea... 31 0.63 At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) riboso... 28 4.4 At3g17750.1 68416.m02265 protein kinase family protein contains ... 28 5.8 At2g01500.1 68415.m00073 homeobox-leucine zipper transcription f... 28 5.8 At4g23290.2 68417.m03357 protein kinase family protein contains ... 27 7.7 At4g23290.1 68417.m03356 protein kinase family protein contains ... 27 7.7 At4g23260.1 68417.m03353 protein kinase family protein contains ... 27 7.7 At3g04740.1 68416.m00510 expressed protein (SWP1) 27 7.7 >At5g16750.1 68418.m01961 transducin family protein / WD-40 repeat family protein contains 8 WD-40 repeats (PF00400); similar to transducin homolog sazD - Homo sapiens, EMBL:U02609 Length = 876 Score = 31.1 bits (67), Expect = 0.63 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 105 PRNEFIENEDNINMSEESTSEPNSSLPYRSYQTQKSAHKLFKKKILQNSFG 257 P++E + +D I E+ T E P R ++QKS K KK+++ + G Sbjct: 821 PKDEKKKEKDVIAAMEQDTDELKQETPSRKRKSQKSKGKSNKKRLIAEAQG 871 >At5g58420.1 68418.m07315 40S ribosomal protein S4 (RPS4D) ribosomal protein S4, Arabidopsis thaliana, PIR:T48480 Length = 262 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 5/48 (10%) Frame = +3 Query: 450 MCKTSRASILKGNIPFLATYNG--FKYPQ---RPVDLPELDIIAERLI 578 +CK + IP+L TY+G +YP +P D +LD+ A +++ Sbjct: 123 LCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLDLEANKIV 170 >At3g17750.1 68416.m02265 protein kinase family protein contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1138 Score = 27.9 bits (59), Expect = 5.8 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 91 NFTTSRGMNSLKMKTISTCLKSQHRSQILACHTVAIKLKNQHI-SYLKKRSYRIPLV 258 NF G+ +K + +KS R +I + + H+ SY++ RSYR P V Sbjct: 946 NFLHGLGLIHCDLKPENILIKSYSRCEIKVIDLGSSCFETDHLCSYVQSRSYRAPEV 1002 >At2g01500.1 68415.m00073 homeobox-leucine zipper transcription factor family protein similar to wuschel protein (GI:22087128) [Arabidopsis thaliana] Length = 271 Score = 27.9 bits (59), Expect = 5.8 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = +3 Query: 78 LMKWKFYNQPRNEFIENEDNINMSEESTSEPN--SSLPYRSYQTQKSAHKLFKKKILQNS 251 L+ W QP E I ++N+N EE T + + P R YQ +K+ + K K Sbjct: 205 LVTWSITQQP--EEINIDENVNGEEEETRDNRTLNLFPVREYQ-EKTGRLIEKTK----- 256 Query: 252 FGHACNVC 275 ACN C Sbjct: 257 ---ACNYC 261 >At4g23290.2 68417.m03357 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 690 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -3 Query: 556 SNSGKSTGLCGYLKPLYVA------KKGILPFKILALEVL 455 +N+G+ G GY+ P YVA K + F +L LE++ Sbjct: 520 ANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEII 559 >At4g23290.1 68417.m03356 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 600 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/40 (35%), Positives = 22/40 (55%), Gaps = 6/40 (15%) Frame = -3 Query: 556 SNSGKSTGLCGYLKPLYVA------KKGILPFKILALEVL 455 +N+G+ G GY+ P YVA K + F +L LE++ Sbjct: 430 ANTGRVVGTFGYMPPEYVANGQFSTKSDVYSFGVLILEII 469 >At4g23260.1 68417.m03353 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 579 Score = 27.5 bits (58), Expect = 7.7 Identities = 13/41 (31%), Positives = 22/41 (53%), Gaps = 6/41 (14%) Frame = -3 Query: 559 ISNSGKSTGLCGYLKPLYVA------KKGILPFKILALEVL 455 ++N+G+ G GY+ P YV K + F +L LE++ Sbjct: 415 VANTGRVVGTFGYMSPEYVTHGQFSMKSDVYSFGVLILEII 455 >At3g04740.1 68416.m00510 expressed protein (SWP1) Length = 1703 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -3 Query: 574 SLSAIISNSGKSTGLCGYLKPLYVAKKGILPFKILALEVLHIM 446 +LS +S S K+ G C Y + A KG P + +LH++ Sbjct: 824 TLSTAVSTSTKTIG-CSYGNLIAEANKGNAPSSVFVYALLHVV 865 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,145,670 Number of Sequences: 28952 Number of extensions: 258245 Number of successful extensions: 654 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 638 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -