BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1053 (539 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 24 0.74 EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 21 6.9 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 24.2 bits (50), Expect = 0.74 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -3 Query: 246 E*RNIAITSPIRVIPMSLRYSLFRSNSISLWILFSV 139 E RN+ +TS ++++ L + R SI +LFS+ Sbjct: 238 EERNVVVTSVLKLMQNKLEITACRLFSIDNALLFSI 273 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 458 NIDESEKNLKKARLIRFGSTGLTQLV 535 N+D ++ NLKK ++ + L LV Sbjct: 71 NLDVNQGNLKKFNALKLKNPNLKTLV 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,758 Number of Sequences: 336 Number of extensions: 2700 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13201902 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -