BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1052 (669 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g23520.1 68418.m02760 expressed protein 28 6.5 At4g10770.1 68417.m01757 oligopeptide transporter OPT family pro... 27 8.5 At2g25300.1 68415.m03026 galactosyltransferase family protein co... 27 8.5 >At5g23520.1 68418.m02760 expressed protein Length = 435 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 186 PISQEPII*LQNKNCSSQTIDGCCTPKP 103 P S+ P + +NK+C +Q GCC KP Sbjct: 67 PPSRFPAL-TENKDCGNQERGGCCRRKP 93 >At4g10770.1 68417.m01757 oligopeptide transporter OPT family protein similar to oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 766 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/32 (34%), Positives = 23/32 (71%) Frame = +1 Query: 169 WLLADWCSYYVIFSRKPHVYYDKSNFVISEAI 264 W+LA + S +V+F +P++ + + N+V+S A+ Sbjct: 684 WVLAGFLSGFVVFRYRPNL-WQRYNYVLSGAL 714 >At2g25300.1 68415.m03026 galactosyltransferase family protein contains Pfam profile: PF01762 galactosyltransferase Length = 341 Score = 27.5 bits (58), Expect = 8.5 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 137 LEQFLF*SQIIGSWLIGVLIT*FSVENLMCITIK 238 L+ + F IGSW+IGV T L C +I+ Sbjct: 305 LKTYAFDDTSIGSWMIGVQATYIDDNRLCCSSIR 338 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,310,500 Number of Sequences: 28952 Number of extensions: 223237 Number of successful extensions: 408 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 399 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -