BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1050 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 27 0.15 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 27.1 bits (57), Expect = 0.15 Identities = 20/80 (25%), Positives = 33/80 (41%) Frame = -1 Query: 455 LVEFIALVSARLFHCILFIFSLHKTFLLNVRVLFKCPLWHSITFLIVCLRKKLRSLLGYL 276 +V L+ F+C IF++H FLL + F + ++ L C L +L Sbjct: 137 VVPLFFLLCIYYFYCAFIIFTVHLLFLLCIYHFFCAFIIFTMHLLFCCAFIFFNMHLLFL 196 Query: 275 FTQ*YLVLENLYI*KSMCLY 216 Y L L++ C+Y Sbjct: 197 LCLDYFTLHLLFL---PCIY 213 Score = 26.6 bits (56), Expect = 0.20 Identities = 13/41 (31%), Positives = 20/41 (48%), Gaps = 5/41 (12%) Frame = -1 Query: 419 FHCILFIFSLHKTFLL-----NVRVLFKCPLWHSITFLIVC 312 F+C+ F++H FLL V +LF CP ++C Sbjct: 59 FYCVSITFNVHLLFLLCSGYFTVHLLFYCPFIIFTVHFLLC 99 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -1 Query: 422 LFHCILFIFSLHKTFLLNVRVLFKCPL 342 LF C IF++H FLL + F C L Sbjct: 267 LFCCAFIIFTMHLLFLLCI-YYFYCAL 292 Score = 22.2 bits (45), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -1 Query: 419 FHCILFIFSLHKTFLLNV 366 F+C ++ L TF LNV Sbjct: 312 FYCAFSLYPLKSTFYLNV 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,502 Number of Sequences: 336 Number of extensions: 3281 Number of successful extensions: 7 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -