BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1050 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_07_0074 - 27509124-27509199,27509613-27512143 31 1.2 01_07_0123 + 41206782-41206844,41207701-41207782,41208587-412087... 28 8.3 >05_07_0074 - 27509124-27509199,27509613-27512143 Length = 868 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +1 Query: 427 AETSAMNSTSAALP-QWPTKRKSLRPFLRNSYSTQQPPSFFLPRS 558 A+ +A+N SA L ++P + RPF+ S + PSFF P S Sbjct: 182 ADGTAVNLLSAVLRVRYPGRANLTRPFVTGSLESTDSPSFFEPVS 226 >01_07_0123 + 41206782-41206844,41207701-41207782,41208587-41208717, 41208758-41209147 Length = 221 Score = 27.9 bits (59), Expect = 8.3 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Frame = -1 Query: 422 LFHCILFIFSLHK--TFLLNVRVLFKCPLWHSITFLIVCLRKKLRSLLGYLFTQ 267 ++HCIL FSLH F+++ +FK P +S T++I K+ L L TQ Sbjct: 98 IYHCILLNFSLHYQILFVISKPDVFKSP--NSDTYVIFG-EAKIEDLSSQLQTQ 148 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,055,986 Number of Sequences: 37544 Number of extensions: 285992 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -