BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1050 (704 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_52586| Best HMM Match : Hexokinase_2 (HMM E-Value=0.85) 29 4.9 SB_21761| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 >SB_52586| Best HMM Match : Hexokinase_2 (HMM E-Value=0.85) Length = 356 Score = 28.7 bits (61), Expect = 4.9 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +1 Query: 469 QWPTKRKSLRPFLR--NSYSTQQPPSFF 546 QW R++L+PFLR N Y+ ++ FF Sbjct: 323 QWAVVRRTLKPFLRRTNEYNQEERVDFF 350 >SB_21761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = -3 Query: 210 PYRTKTTKLISMKISGHLQIGPADDPF*LLFSSST 106 P RT++ ++S K++G + GP P L+F ST Sbjct: 133 PLRTESAAVVSRKLAGIYEEGPLTWPKVLMFDDST 167 >SB_10895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 496 Score = 28.7 bits (61), Expect = 4.9 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 463 LPQWPTKRKSLRPFLRNSYSTQQPPSFFLPRSAYSPFY 576 +P +PT R L PF + T P+F+ P S + +Y Sbjct: 394 MPAFPTLRLPLHPFASTGFGT---PAFYNPSSYHREYY 428 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,401,607 Number of Sequences: 59808 Number of extensions: 354514 Number of successful extensions: 785 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1853669818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -