BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1050 (704 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51995-8|AAA96076.1| 331|Caenorhabditis elegans Dystroglycan pr... 30 1.9 Z81457-5|CAB03817.2| 584|Caenorhabditis elegans Hypothetical pr... 28 7.5 AL034488-13|CAA22460.2| 345|Caenorhabditis elegans Hypothetical... 28 7.5 >U51995-8|AAA96076.1| 331|Caenorhabditis elegans Dystroglycan protein 3 protein. Length = 331 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -3 Query: 276 VYTMILGT*KSLYLKVNVFIYAPYRTKTTKLISMKI 169 +Y + G KSLY ++ F+ +PY K +K+++ I Sbjct: 279 IYFLFFGEMKSLYALMHDFLVSPYSLKLSKMLAKMI 314 >Z81457-5|CAB03817.2| 584|Caenorhabditis elegans Hypothetical protein C01G12.7 protein. Length = 584 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = -1 Query: 683 LPTKCLTWVVTHKAPIGSKLHEYRSESWF 597 +P + +T V+T P SK+ EY + W+ Sbjct: 1 MPEEIVTRVITFFFPYDSKVEEYENSDWY 29 >AL034488-13|CAA22460.2| 345|Caenorhabditis elegans Hypothetical protein Y54G11A.12 protein. Length = 345 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -3 Query: 225 VFIYAPYRTKTTKLISMKI 169 +FIY PYR T KLI KI Sbjct: 301 IFIYKPYRVYTKKLIFYKI 319 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,623,088 Number of Sequences: 27780 Number of extensions: 284698 Number of successful extensions: 657 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 657 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1634564590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -