BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1044 (576 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57743| Best HMM Match : LIM (HMM E-Value=1.7e-08) 28 4.8 SB_27731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_57743| Best HMM Match : LIM (HMM E-Value=1.7e-08) Length = 197 Score = 28.3 bits (60), Expect = 4.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 420 RNYKSYYIIINRDVSRRARPRHCFILKFLQRLLSLNYIKRGM 545 ++Y ++I + + R C +L FLQR +L Y+ +G+ Sbjct: 52 QSYSLLSLVIRKTRQSQVTSRTCRLLDFLQRPSALYYVHKGL 93 >SB_27731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 6.3 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 2/64 (3%) Frame = +1 Query: 370 TKFSTNNVSL-FNQQ*YSETINHT-IL**IETLVDERDHDTVLSLNSYNDYSL*ITLNVE 543 TK NN+ + +N T T + I T ++ HD +S+N+ N+ + IT+N+ Sbjct: 18 TKVDINNIDINYNMNTSINTNTRTNVKISITTHQHQQQHDINISINTNNNIDINITININ 77 Query: 544 WNDA 555 N A Sbjct: 78 NNIA 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,815,715 Number of Sequences: 59808 Number of extensions: 261489 Number of successful extensions: 379 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1373676929 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -