BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1043 (417 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 22 7.8 AJ000037-1|CAA03873.1| 94|Anopheles gambiae D3 protein protein. 22 7.8 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 246 ECAVTMTSERAIPHLRDIFGLSQQYDGNCKNFDEN 350 +C +++++E ++ + G S Q DG C N E+ Sbjct: 35 QCQISVSAET----MKSLHGGSMQPDGTCDNLWES 65 >AJ000037-1|CAA03873.1| 94|Anopheles gambiae D3 protein protein. Length = 94 Score = 22.2 bits (45), Expect = 7.8 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 246 ECAVTMTSERAIPHLRDIFGLSQQYDGNCKNFDEN 350 +C +++++E ++ + G S Q DG C N E+ Sbjct: 35 QCQISVSAET----MKSLHGGSMQPDGTCDNLWES 65 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 450,130 Number of Sequences: 2352 Number of extensions: 8566 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34205040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -