BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1039 (682 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q013W3 Cluster: BAP28-related; n=3; Ostreococcus|Rep: B... 33 4.9 >UniRef50_Q013W3 Cluster: BAP28-related; n=3; Ostreococcus|Rep: BAP28-related - Ostreococcus tauri Length = 2277 Score = 33.5 bits (73), Expect = 4.9 Identities = 19/71 (26%), Positives = 34/71 (47%) Frame = -3 Query: 656 RFHSHSLSIFFGGKTP*NTVLNVLRKDHCKIYNIFNLIESVLQWHLYIIF*CGILCLSTC 477 R + LS +F + T+ ++R+ +Y++ +LI L WH F + C+ TC Sbjct: 99 RAYLRLLSGYFTERAAGATIEWLIRRFKVHVYDVDDLIACGLPWHSTAAF---VRCVQTC 155 Query: 476 FVEIQNCFSWM 444 +E F W+ Sbjct: 156 QLENSKHFKWL 166 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 654,618,148 Number of Sequences: 1657284 Number of extensions: 12848180 Number of successful extensions: 25219 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 24463 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25213 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 52892566912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -