BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1039 (682 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharom... 26 5.8 SPBC1734.07c |||TRAPP complex subunit Trs85 |Schizosaccharomyces... 25 7.7 >SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 25.8 bits (54), Expect = 5.8 Identities = 20/69 (28%), Positives = 36/69 (52%), Gaps = 5/69 (7%) Frame = -2 Query: 384 QKHFYLLLKSHLTL*NYRN*SKTVGEVCSEQRLQIFIFKISLMQ----P*WPLKNVLA-K 220 Q+ F+LL+KS TL + C ++ LQ ++ +Q P WP++N+LA Sbjct: 179 QRPFFLLIKS--TLDEWTIAPLKELSHCVDKSLQFYLVAEDSVQLAEYPSWPVRNILAFA 236 Query: 219 VLRFFLTIL 193 ++F L ++ Sbjct: 237 FIKFKLKVI 245 >SPBC1734.07c |||TRAPP complex subunit Trs85 |Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 25.4 bits (53), Expect = 7.7 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +1 Query: 604 FYGVFPPKKIDSEWEWNRGLFYQE 675 F P K+D WN GL Y + Sbjct: 493 FLSCLPAPKVDDAANWNAGLLYSK 516 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,911,416 Number of Sequences: 5004 Number of extensions: 61738 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 313902888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -