BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1037 (640 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0U7W1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.20 >UniRef50_Q0U7W1 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 967 Score = 37.9 bits (84), Expect = 0.20 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = -1 Query: 319 PLTGPAHSFGLPFVHSFVQRSPGDLEGFG*SRGITVFLNLSAFLVCFDEGF 167 P P SF P +HS V +PG L G G R ++ N+S F FDE + Sbjct: 849 PNANPFASFTFPSIHSHVNSTPGSLRG-GRGRSSSMLSNISGFTDGFDEPY 898 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 582,484,635 Number of Sequences: 1657284 Number of extensions: 10914406 Number of successful extensions: 20234 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 19802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20229 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 47711253245 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -