BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1037 (640 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6422| Best HMM Match : Gemini_AC4_5 (HMM E-Value=6.7) 29 3.2 SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 4.2 SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 4.2 SB_39539| Best HMM Match : VWA (HMM E-Value=1.8e-12) 28 7.4 >SB_6422| Best HMM Match : Gemini_AC4_5 (HMM E-Value=6.7) Length = 442 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = +2 Query: 542 VRFRGKSRVTPDYCLGH-YIQGVSKERSLR 628 V FRG R+ DY L H Y+ V K R +R Sbjct: 122 VHFRGNERILFDYALSHKYVNDVCKLRIMR 151 >SB_30986| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 2682 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +2 Query: 455 GIVWFPSF-----VFFWYFLKRY*SNVYV*FELQVR 547 G++W +F VF+ LKRY S VY F L+ R Sbjct: 167 GVIWVSAFAMRFPVFYGLTLKRYGSKVYCVFNLETR 202 >SB_39349| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 1125 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +2 Query: 455 GIVWFPSF-----VFFWYFLKRY*SNVYV*FELQVR 547 G++W +F VF+ LKRY S VY F L+ R Sbjct: 910 GVIWVSAFAMRFPVFYGLTLKRYGSKVYCVFNLETR 945 >SB_39539| Best HMM Match : VWA (HMM E-Value=1.8e-12) Length = 515 Score = 27.9 bits (59), Expect = 7.4 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 385 SWTLFVVAYFFRWDHVMYVGLENW 456 +W L+++A R++HVM +NW Sbjct: 459 AWQLYLIASHPRYEHVMIGSYDNW 482 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,150,654 Number of Sequences: 59808 Number of extensions: 364905 Number of successful extensions: 537 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 537 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -