BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1037 (640 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 25 2.7 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 8.2 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 24.6 bits (51), Expect = 2.7 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = +1 Query: 343 YKTKRYHYVASAY*SWTLFVVAYFFRWDHVMYVGLEN 453 + R+H+ + TLF V+ F W ++YV +++ Sbjct: 1047 WSRNRFHFDDVSKAMLTLFTVSTFEGWPGLLYVSIDS 1083 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.0 bits (47), Expect = 8.2 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -2 Query: 309 VPPIHSAFHSFTHSFNDHLGTWKVSDNL 226 VPP+ ++ H FT F+ GT V +L Sbjct: 827 VPPLPNSQHYFTQPFSPSGGTTPVPVSL 854 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,772 Number of Sequences: 2352 Number of extensions: 11892 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -