BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1037 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70212-5|CAA94165.3| 320|Caenorhabditis elegans Hypothetical pr... 28 6.5 AC006714-2|AAK29716.2| 689|Caenorhabditis elegans Hypothetical ... 27 8.6 >Z70212-5|CAA94165.3| 320|Caenorhabditis elegans Hypothetical protein R04D3.7 protein. Length = 320 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/59 (22%), Positives = 26/59 (44%) Frame = +1 Query: 322 HVKSALCYKTKRYHYVASAY*SWTLFVVAYFFRWDHVMYVGLENWNCMVSVFCFFLVLS 498 H ++ +CY +S WT+F+ F ++ +V L N + + F ++S Sbjct: 81 HFEAFICYSMMHVLQTSSLISGWTVFLTT-FMKYQAAKHVVLPKKNIWIVICVIFAIIS 138 >AC006714-2|AAK29716.2| 689|Caenorhabditis elegans Hypothetical protein Y119D3B.14 protein. Length = 689 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 385 INTHSLHNGSVLFYSTKQT*RGPL 314 I T SLHN S +F +++ T GPL Sbjct: 294 IYTGSLHNNSTIFNTSQMTSEGPL 317 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,519,847 Number of Sequences: 27780 Number of extensions: 268023 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 479 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 489 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -