BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1036 (414 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI000051A42F Cluster: PREDICTED: similar to CG1213-PA,... 31 7.1 UniRef50_Q628B7 Cluster: Putative uncharacterized protein CBG004... 31 9.3 >UniRef50_UPI000051A42F Cluster: PREDICTED: similar to CG1213-PA, isoform A; n=1; Apis mellifera|Rep: PREDICTED: similar to CG1213-PA, isoform A - Apis mellifera Length = 526 Score = 31.5 bits (68), Expect = 7.1 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -1 Query: 249 MWFIENPFFIALMGERAHNAPDVKCFSGARGHHYVNAATQLET*GLS 109 +WF E+P F+A+ G + + + F G R + V L GLS Sbjct: 224 IWFPESPHFLAVRGRKTEASQSIAFFKGIRDPNEVKKELSLILRGLS 270 >UniRef50_Q628B7 Cluster: Putative uncharacterized protein CBG00449; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG00449 - Caenorhabditis briggsae Length = 1540 Score = 31.1 bits (67), Expect = 9.3 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -3 Query: 346 PVNLNTLKYKRKNVKRLTNI*DN*SI*IEKSCDVVHRK-SLFYCVN-GGTSSQRA 188 P + R N K LTN+ DN + K C+V+H K +L+ C G T+ QRA Sbjct: 440 PATFEWISNVRSNQK-LTNLRDNQTHIYRKRCNVMHLKHTLYICTTVGDTNVQRA 493 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 393,666,173 Number of Sequences: 1657284 Number of extensions: 6886768 Number of successful extensions: 13795 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13793 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 19042509735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -