BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1030 (514 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.9 AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase pro... 22 3.2 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 5.7 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 9.9 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 1.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 361 LRVAPEEHPVLLTEAPLNPKANREKM 438 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AY526236-1|AAS20469.1| 85|Apis mellifera epoxide hydrolase protein. Length = 85 Score = 22.2 bits (45), Expect = 3.2 Identities = 10/37 (27%), Positives = 17/37 (45%) Frame = -3 Query: 509 YSESTVWMATYMAGVLNVSNMIWVIFSLLALGLRGAS 399 + E + + M LN+SN+ W+ L GA+ Sbjct: 17 FPEKIIGLHNNMCTSLNLSNLFWLFVGTYFPSLIGAN 53 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 124 GMCKAGFAGD 153 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 20.6 bits (41), Expect = 9.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 513 RVQREHGLDGDVHGG 469 RV ++G+ GD +GG Sbjct: 63 RVYDKNGMTGDAYGG 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,453 Number of Sequences: 438 Number of extensions: 3458 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14232156 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -