BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1028 (695 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0476 + 6215401-6217445,6217538-6217630,6218031-6218133,621... 31 1.2 >04_01_0476 + 6215401-6217445,6217538-6217630,6218031-6218133, 6218237-6218254 Length = 752 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/50 (38%), Positives = 28/50 (56%), Gaps = 4/50 (8%) Frame = -3 Query: 627 NFTKQLICKS---SFENTKSRQFNVRIMNSLRN-GSLFVFQLRSPAGLHP 490 N +ICK+ S+ T++ FN + +L+ GSL V LR PAG+ P Sbjct: 592 NLRSLIICKADVASWSWTRTSNFNYALEETLKELGSLRVLVLRHPAGVLP 641 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,106,923 Number of Sequences: 37544 Number of extensions: 322861 Number of successful extensions: 540 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 540 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1780264028 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -