BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1025 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 24 1.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 1.8 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 9.7 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 21 9.7 AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase l... 21 9.7 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -2 Query: 697 LYILILTKIIHSPKTLINIITFNKQKTYTMDSN*LLD 587 L+++ L + + I +ITF K++ D N L D Sbjct: 241 LFVIYLCGRVMEEQNKIRLITFEMNKSFERDKNKLGD 277 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/24 (33%), Positives = 15/24 (62%) Frame = +1 Query: 406 RKLAPQLTSPTSPAVVQSRVHFHQ 477 R +PQ ++PT P +V+ + H+ Sbjct: 90 RSSSPQTSAPTGPPIVRCALRKHK 113 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.0 bits (42), Expect = 9.7 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 98 IPNLNFIHRYFFLFGRGRNLLEFWLLHS 15 + N+ I FF F R R L WL H+ Sbjct: 641 VGNMTLILDKFF-FPRWRQTLAMWLNHN 667 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 21.0 bits (42), Expect = 9.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 199 FLFSILTLPPPGLYVALSRDPILDFT 122 F+F+ +TL GLY L L+F+ Sbjct: 447 FIFTFITLLTIGLYFQLCEFSRLNFS 472 >AF260822-1|AAG02020.1| 138|Tribolium castaneum alpha-esterase like protein E3 protein. Length = 138 Score = 21.0 bits (42), Expect = 9.7 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = -1 Query: 95 PNLNFIHRYFFLFGRGRN 42 P L +IH +F+FG G + Sbjct: 74 PVLVWIHGGYFIFGSGND 91 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,742 Number of Sequences: 336 Number of extensions: 3985 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -