BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1024 (537 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0378 - 28438918-28439064,28439280-28439313,28439859-284399... 28 5.4 08_02_0093 + 12269953-12270507 27 7.2 07_03_1406 + 26343915-26346032 27 9.5 >02_05_0378 - 28438918-28439064,28439280-28439313,28439859-28439963, 28440402-28441558 Length = 480 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = -2 Query: 131 VGARVVYDVGDGGSVTTTPRQSLVC*SAGCAASRRGWLWLRR 6 V A + VGD R+SL+ + A RRG WLRR Sbjct: 436 VVAEIGERVGDPRGTGLQERRSLMAVGSWIGAKRRGGYWLRR 477 >08_02_0093 + 12269953-12270507 Length = 184 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +3 Query: 306 SNRHYMCKCISKIRQRYIN*SRLLSQVCGVNVS 404 +NR C SK RQ I + LS +CGVNV+ Sbjct: 12 ANRKARDVCFSKRRQVVIKKANELSILCGVNVA 44 >07_03_1406 + 26343915-26346032 Length = 705 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 3 RPSEPKPTSPARGAPCRSTNEALARRGRH 89 RP P SPA + C A ARRG H Sbjct: 19 RPRLPPLASPATTSTCAPAPAATARRGSH 47 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,891,689 Number of Sequences: 37544 Number of extensions: 225545 Number of successful extensions: 493 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 488 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 493 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1186491600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -