BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1017 (697 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) 32 0.39 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 30 2.1 SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 SB_40869| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.3 >SB_53461| Best HMM Match : Amelogenin (HMM E-Value=0.099) Length = 2489 Score = 32.3 bits (70), Expect = 0.39 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = -1 Query: 130 HVLASCPETVSLIWFILECDWISDVEQPVSLYCACYF 20 + L E L+WF+ EC + V+Q V LYC C F Sbjct: 2157 YALYGLTERAMLVWFVSEC---AVVKQGVMLYCECRF 2190 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 29.9 bits (64), Expect = 2.1 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 3/79 (3%) Frame = +3 Query: 258 KSTQKFTWRARSIAPQ*KAARQLRRRHDALVNARR---DSTECASRRGDEKDAGE*RSPP 428 +S +K +RS +P+ K +R R+R + + R DS+ C RR + Sbjct: 273 RSHRKHRSHSRSRSPRSKRSRSPRKRRRSKSRSPRRYRDSSSCRRRRSRSRSRSPKSRLR 332 Query: 429 QRNRAALCIELIDRARPQR 485 R+R+ I R+RP R Sbjct: 333 SRSRSPYRIRYRSRSRPPR 351 >SB_19217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 28.3 bits (60), Expect = 6.3 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 504 CHSHFTATRPSDSTYPSHKHAVPIATS 584 CH H A+RP+ + + +HA P+ S Sbjct: 53 CHRHSMASRPNSAQSSAFRHATPLDLS 79 >SB_40869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 28.3 bits (60), Expect = 6.3 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 3/57 (5%) Frame = +3 Query: 501 LCHSHFTATRPSDSTYPSHKHAVPIATSWTTSMSKNRSRCLFH---REYFVATISFM 662 L HSH S +H H +A S T ++ + ++CL H RE V +S M Sbjct: 309 LAHSHTKGLAHSHIKGLAHGHTKGLAHSHTKGLAHSHTKCLAHSRPREKAVQALSAM 365 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,927,703 Number of Sequences: 59808 Number of extensions: 418260 Number of successful extensions: 1143 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1050 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1141 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1817559367 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -