BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1013 (456 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.34 SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) 30 1.0 SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) 29 1.8 SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) 29 2.4 SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.2 SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) 28 3.2 SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.2 SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) 27 7.4 SB_57606| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_57172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_34802| Best HMM Match : SBP (HMM E-Value=7.9) 27 9.7 SB_19121| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_2774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 55.6 bits (128), Expect = 2e-08 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 5/79 (6%) Frame = +1 Query: 22 SVKVHPVVLFQIVDAYERRN--ADSHRVIGTLLGTSDKGVVEVTNCFCVPHKE-HADQVE 192 +V VHP+VL +VD + R RV+G LLG+ KGV++V NCF VP E DQ Sbjct: 10 TVVVHPIVLLSVVDHFNRMGKVGSQKRVVGVLLGSRRKGVLDVANCFAVPFDEDDRDQNV 69 Query: 193 --AELNYAMDVYELNRRVN 243 + +Y ++Y + ++VN Sbjct: 70 WFLDHDYLENMYAMFKKVN 88 >SB_33661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 425 Score = 48.8 bits (111), Expect = 2e-06 Identities = 27/83 (32%), Positives = 42/83 (50%), Gaps = 1/83 (1%) Frame = +1 Query: 25 VKVHPVVLFQIVDAYERRNADSHRVIGTLLGTSDKGVVEVTNCFCVP-HKEHADQVEAEL 201 V+V + + +I+ E + V G LLG +E+TNCF P +K D+ + ++ Sbjct: 18 VQVDGLTVLKIIKHCEEEGSSGDLVQGVLLGLIQDNRLEITNCFPFPSNKAGDDEDDDDV 77 Query: 202 NYAMDVYELNRRVNSSESIVGWW 270 NY M+V R VN VGW+ Sbjct: 78 NYQMEVMRRLRAVNIDHLHVGWY 100 >SB_36852| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 31.5 bits (68), Expect = 0.34 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +1 Query: 187 VEAELNYAMDVYELNRRVNSSESIVG 264 V EL YA +YEL+++ N +E IVG Sbjct: 1 VAVELEYAKSMYELSQKANPNEQIVG 26 >SB_20447| Best HMM Match : zf-C4 (HMM E-Value=2.09999e-41) Length = 419 Score = 29.9 bits (64), Expect = 1.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 18 Y*CKGPSCCFISNCGRIRTSKCRF 89 Y C+G + CFI R R KCRF Sbjct: 76 YTCRGSNDCFIDKVHRNRCQKCRF 99 >SB_29584| Best HMM Match : DUF1106 (HMM E-Value=8.6) Length = 219 Score = 29.1 bits (62), Expect = 1.8 Identities = 20/71 (28%), Positives = 33/71 (46%) Frame = -3 Query: 256 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 77 Y+ + CS + PSR +P R R + +R+ W++ +CR P R L ++F Sbjct: 36 YYNYRHVRCSRSREPSR--IPKRFLRRIHNKSRKLRWVVYHRICRKIP-RSSNLHNYINF 92 Query: 76 DVRMRPQFEIK 44 R F+ K Sbjct: 93 GRLRRRYFDSK 103 >SB_58027| Best HMM Match : zf-C4 (HMM E-Value=0) Length = 396 Score = 28.7 bits (61), Expect = 2.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 6 NGSQY*CKGPSCCFISNCGRIRTSKCRFSQ 95 N + Y C+G + C I R R CRF + Sbjct: 87 NNTNYTCRGQNTCAIDRNSRSRCPSCRFQK 116 >SB_47404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 28.3 bits (60), Expect = 3.2 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = -3 Query: 256 YFQRN*LFCSARKHPSRN*VPLRLDRHVLCVARRSSWLLPPLLCRSCPIRCR*LCENLHF 77 Y+ + CS + PSR +P R R + +R+ W++ +CR+ P R L ++F Sbjct: 90 YYNYRHVRCSRSREPSR--IPKRFLRRLHNKSRKLRWVVYHRICRNIP-RSSNLHNYINF 146 Query: 76 D-VRMRP 59 +R RP Sbjct: 147 GRLRRRP 153 >SB_4183| Best HMM Match : APH_6_hur (HMM E-Value=7.4) Length = 270 Score = 28.3 bits (60), Expect = 3.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 351 YSGHFTGWRSNGFTCICL 404 ++GH W SNG TC+ L Sbjct: 201 FNGHTYSWHSNGVTCVLL 218 >SB_32431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 322 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 342 CPCYSGHFTGWRSNGFTCIC 401 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_32430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 342 CPCYSGHFTGWRSNGFTCIC 401 CPC +G + +GFTCIC Sbjct: 130 CPCKNGGHCVNKVDGFTCIC 149 >SB_503| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 979 Score = 27.1 bits (57), Expect = 7.4 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 4/48 (8%) Frame = +1 Query: 133 VVEVTNCFCVPHKEHADQVEAELNYAMDVYELN----RRVNSSESIVG 264 ++ + +C + HKEHAD+ E++ A+ ++ LN R + + E VG Sbjct: 706 IIALNSCRVMLHKEHADE-ESDYINAVFLHRLNSFTSREIPAEEKSVG 752 >SB_57606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 26.6 bits (56), Expect = 9.7 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -1 Query: 300 GVVGYF-IASRPPTNNTFRG-IDSSVQLVNIHRVIKFRFDLIGMFF--VWHAEAVGYFHH 133 GV+ Y R P ++TF G + V + + I D G + V+H + VG+FHH Sbjct: 28 GVLDYTDYVLRGPFHDTFLGPFEPCVAQEGVFQNITCVLDEDGFYVNGVFHCKEVGFFHH 87 Query: 132 S 130 + Sbjct: 88 N 88 >SB_57172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 26.6 bits (56), Expect = 9.7 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -1 Query: 300 GVVGYF-IASRPPTNNTFRG-IDSSVQLVNIHRVIKFRFDLIGMFF--VWHAEAVGYFHH 133 GV+ Y R P ++TF G + V + + I D G + V+H + VG+FHH Sbjct: 4 GVLDYTNYVLRGPFHDTFLGPFEPCVAQEGVFQNITCILDEDGFYVNGVFHCKEVGFFHH 63 Query: 132 S 130 + Sbjct: 64 N 64 >SB_34802| Best HMM Match : SBP (HMM E-Value=7.9) Length = 283 Score = 26.6 bits (56), Expect = 9.7 Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Frame = -1 Query: 300 GVVGYF-IASRPPTNNTFRG-IDSSVQLVNIHRVIKFRFDLIGMFF--VWHAEAVGYFHH 133 GV+ Y R P ++TF G + V + + I D G + V+H + VG+FHH Sbjct: 4 GVLDYTNYVLRGPFHDTFLGPFEPCVAQEGVFQNITCILDEDGFYVNGVFHCKEVGFFHH 63 Query: 132 S 130 + Sbjct: 64 N 64 >SB_19121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 26.6 bits (56), Expect = 9.7 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = -2 Query: 437 PCFPFGTPNGTQTYARKPIRPPASEVSRVTWTGSRHS 327 P FPF T G + AR+ PPA+ S T T ++HS Sbjct: 148 PQFPFFT--GRKAGARRVGTPPANLASNPTSTTTQHS 182 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,084,314 Number of Sequences: 59808 Number of extensions: 347554 Number of successful extensions: 1330 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 920703675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -