BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1011 (466 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51... 196 1e-49 UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorh... 180 1e-44 UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizom... 159 2e-38 UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukary... 158 6e-38 UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 155 4e-37 UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoid... 152 4e-36 UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillar... 149 4e-35 UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa ... 149 4e-35 UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa;... 149 4e-35 UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypano... 137 1e-31 UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; ... 134 1e-30 UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encepha... 133 2e-30 UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 133 2e-30 UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-... 87 2e-28 UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG1473... 117 1e-25 UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme fam... 98 1e-19 UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizo... 92 5e-18 UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermat... 91 1e-17 UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Euk... 90 3e-17 UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 89 4e-17 UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryo... 88 1e-16 UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheri... 87 2e-16 UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, wh... 87 2e-16 UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, C... 86 3e-16 UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC ... 86 3e-16 UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 85 5e-16 UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa ... 85 5e-16 UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomyc... 85 7e-16 UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55... 85 7e-16 UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=12... 85 9e-16 UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 84 2e-15 UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 84 2e-15 UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 83 3e-15 UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridip... 83 4e-15 UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukary... 82 5e-15 UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 81 9e-15 UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=... 81 2e-14 UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 81 2e-14 UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobas... 81 2e-14 UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramec... 80 2e-14 UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-... 80 3e-14 UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 80 3e-14 UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichoc... 79 4e-14 UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; D... 79 4e-14 UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia... 79 6e-14 UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 79 6e-14 UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encepha... 79 6e-14 UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-... 78 8e-14 UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichoc... 78 8e-14 UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 78 1e-13 UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryom... 78 1e-13 UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16... 78 1e-13 UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 77 1e-13 UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 ... 77 2e-13 UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia... 77 2e-13 UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative... 77 2e-13 UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidi... 77 2e-13 UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya... 77 3e-13 UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 76 3e-13 UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezi... 76 3e-13 UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypano... 75 6e-13 UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piropla... 75 6e-13 UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 75 6e-13 UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptos... 75 6e-13 UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosp... 75 6e-13 UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; ... 75 8e-13 UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichom... 75 1e-12 UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichom... 75 1e-12 UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum... 75 1e-12 UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1... 75 1e-12 UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 74 1e-12 UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypano... 74 1e-12 UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26... 74 1e-12 UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=6... 74 1e-12 UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-... 74 2e-12 UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 73 2e-12 UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 73 2e-12 UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichom... 73 2e-12 UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilater... 73 2e-12 UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; ... 73 2e-12 UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kl... 73 2e-12 UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukary... 73 3e-12 UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 73 3e-12 UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Th... 73 3e-12 UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme fam... 73 4e-12 UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella ve... 73 4e-12 UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypano... 72 5e-12 UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E... 72 5e-12 UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Er... 72 5e-12 UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein;... 72 7e-12 UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme fam... 72 7e-12 UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabido... 71 9e-12 UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putati... 71 9e-12 UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveola... 71 9e-12 UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20... 71 9e-12 UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=1... 71 9e-12 UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 71 1e-11 UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramec... 71 1e-11 UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Sacchar... 71 1e-11 UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 71 2e-11 UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidio... 71 2e-11 UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like prote... 70 3e-11 UniRef50_Q4P877 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 70 3e-11 UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; ... 70 3e-11 UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33... 70 3e-11 UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ub... 69 5e-11 UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillar... 69 5e-11 UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoli... 69 7e-11 UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, w... 69 7e-11 UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; ... 69 7e-11 UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; E... 69 7e-11 UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 68 9e-11 UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schisto... 68 9e-11 UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 68 9e-11 UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dict... 68 9e-11 UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichom... 68 9e-11 UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, wh... 68 9e-11 UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichom... 68 1e-10 UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryo... 68 1e-10 UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomyc... 68 1e-10 UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophoph... 67 2e-10 UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 67 2e-10 UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 67 2e-10 UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 67 2e-10 UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme fam... 67 2e-10 UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 67 2e-10 UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 67 2e-10 UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizo... 67 2e-10 UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerot... 67 2e-10 UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein;... 66 3e-10 UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putat... 66 3e-10 UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; ... 66 3e-10 UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 66 3e-10 UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 66 3e-10 UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobas... 66 3e-10 UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Sa... 66 4e-10 UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23... 65 6e-10 UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; ... 65 6e-10 UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahy... 65 8e-10 UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family pro... 65 8e-10 UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 65 8e-10 UniRef50_Q2KGQ4 Cluster: Ubiquitin carrier protein; n=1; Magnapo... 65 8e-10 UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1... 64 1e-09 UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; ... 64 1e-09 UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 64 1e-09 UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD s... 64 2e-09 UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP000... 63 3e-09 UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Re... 63 3e-09 UniRef50_UPI0000213DB4 Cluster: ubiquitin-conjugating enzyme E2L... 63 3e-09 UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypano... 63 3e-09 UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom... 63 3e-09 UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein... 63 3e-09 UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridip... 62 4e-09 UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 62 6e-09 UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha... 62 6e-09 UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomyc... 62 6e-09 UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 62 6e-09 UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmod... 62 8e-09 UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme fam... 61 1e-08 UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Euk... 61 1e-08 UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E... 61 1e-08 UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 60 2e-08 UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukary... 60 2e-08 UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichom... 60 2e-08 UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=... 60 2e-08 UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 60 3e-08 UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida... 60 3e-08 UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 59 4e-08 UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramec... 59 4e-08 UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, who... 59 4e-08 UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=... 59 5e-08 UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ... 59 5e-08 UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellom... 59 5e-08 UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia ... 59 5e-08 UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 59 5e-08 UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, w... 58 7e-08 UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Euka... 58 7e-08 UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella ve... 58 9e-08 UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1;... 58 1e-07 UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypano... 58 1e-07 UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 58 1e-07 UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia... 57 2e-07 UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia... 57 2e-07 UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2; Schisto... 57 2e-07 UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 57 2e-07 UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, wh... 57 2e-07 UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; ... 57 2e-07 UniRef50_A7EC39 Cluster: Putative uncharacterized protein; n=1; ... 57 2e-07 UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; E... 57 2e-07 UniRef50_Q6E689 Cluster: Ubiquitin carrier protein; n=1; Antonos... 57 2e-07 UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 57 2e-07 UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;... 57 2e-07 UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=6... 56 3e-07 UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmod... 56 4e-07 UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; ... 56 4e-07 UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla... 56 5e-07 UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella ve... 56 5e-07 UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergi... 56 5e-07 UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6... 56 5e-07 UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-... 55 7e-07 UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA... 55 9e-07 UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier o... 55 9e-07 UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG1543... 55 9e-07 UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/... 54 1e-06 UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; ... 54 1e-06 UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=... 54 2e-06 UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishma... 54 2e-06 UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24... 54 2e-06 UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU045... 54 2e-06 UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:... 53 3e-06 UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, w... 53 3e-06 UniRef50_UPI0000F2DAA5 Cluster: PREDICTED: hypothetical protein;... 53 4e-06 UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 53 4e-06 UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11... 53 4e-06 UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 52 5e-06 UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=... 52 5e-06 UniRef50_A7F3W6 Cluster: Putative uncharacterized protein; n=2; ... 52 5e-06 UniRef50_Q7QWL1 Cluster: GLP_762_41239_41676; n=1; Giardia lambl... 52 6e-06 UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy... 52 6e-06 UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; ... 52 8e-06 UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti... 52 8e-06 UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 43 1e-05 UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 51 1e-05 UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ... 51 1e-05 UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 51 1e-05 UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy... 50 2e-05 UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; E... 50 2e-05 UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 50 2e-05 UniRef50_Q9XVK5 Cluster: NEDD8-conjugating enzyme ubc-12; n=3; C... 50 3e-05 UniRef50_UPI0000498382 Cluster: ubiquitin-conjugating enzyme; n=... 49 4e-05 UniRef50_Q9ERK8 Cluster: Ubiquitin carrier protein; n=1; Mus mus... 49 4e-05 UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella ve... 49 4e-05 UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 49 4e-05 UniRef50_A2EXE5 Cluster: Ubiquitin-conjugating enzyme family pro... 49 6e-05 UniRef50_Q9VZ73 Cluster: CG17030-PA; n=1; Drosophila melanogaste... 48 8e-05 UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia... 48 8e-05 UniRef50_Q0TYP6 Cluster: Putative uncharacterized protein; n=1; ... 48 8e-05 UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-... 48 1e-04 UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family pro... 48 1e-04 UniRef50_A0DLZ3 Cluster: Chromosome undetermined scaffold_56, wh... 48 1e-04 UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 48 1e-04 UniRef50_A0BSP4 Cluster: Chromosome undetermined scaffold_125, w... 47 2e-04 UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 47 2e-04 UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizom... 47 2e-04 UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa... 46 4e-04 UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, wh... 46 4e-04 UniRef50_UPI0001554972 Cluster: PREDICTED: similar to hCG2039566... 46 5e-04 UniRef50_A7F8T9 Cluster: Putative uncharacterized protein; n=1; ... 45 0.001 UniRef50_Q583A6 Cluster: Ubiquitin-conjugating enzyme E2, putati... 44 0.001 UniRef50_A7EFQ5 Cluster: Putative uncharacterized protein; n=1; ... 44 0.001 UniRef50_A2ADC1 Cluster: Novel protein containing an Ubiquitin-c... 44 0.002 UniRef50_Q0DBY7 Cluster: Os06g0506600 protein; n=1; Oryza sativa... 38 0.002 UniRef50_Q5DB86 Cluster: Ubiquitin carrier protein; n=1; Schisto... 44 0.002 UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypano... 44 0.002 UniRef50_Q54SB7 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 43 0.003 UniRef50_A2FP69 Cluster: Ubiquitin-conjugating enzyme family pro... 43 0.003 UniRef50_Q17PP1 Cluster: Ubiquitin conjugating enzyme, putative;... 43 0.004 UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichom... 43 0.004 UniRef50_Q54YU7 Cluster: Putative uncharacterized protein; n=1; ... 42 0.007 UniRef50_A2DRH5 Cluster: Ubiquitin-conjugating enzyme family pro... 42 0.007 UniRef50_Q5KEU0 Cluster: Ubiquitin conjugating enzyme, putative;... 42 0.007 UniRef50_Q4PHG2 Cluster: Putative uncharacterized protein; n=1; ... 42 0.009 UniRef50_Q8IDP1 Cluster: Ubiquitin-conjugating enzyme, putative;... 41 0.012 UniRef50_Q7RQ91 Cluster: Ubiquitin-conjugating enzyme e2-17 kDa;... 41 0.012 UniRef50_Q4YQ76 Cluster: Ubiquitin-conjugating enzyme e2-17 kDa,... 41 0.012 UniRef50_Q20872 Cluster: Ubiquitin e2 (Conjugating enzyme) varia... 41 0.012 UniRef50_UPI00015B6132 Cluster: PREDICTED: similar to Aktip prot... 41 0.015 UniRef50_A2FDU2 Cluster: Ubiquitin-conjugating enzyme family pro... 41 0.015 UniRef50_UPI0000E48D7E Cluster: PREDICTED: hypothetical protein;... 40 0.020 UniRef50_UPI0000519E33 Cluster: PREDICTED: similar to fused toes... 40 0.020 UniRef50_Q4DIQ3 Cluster: Ubiquitin-conjugating enzyme E2, putati... 40 0.020 UniRef50_A6SCL8 Cluster: Putative uncharacterized protein; n=1; ... 40 0.020 UniRef50_UPI0000DBF7F5 Cluster: similar to ubiquitin-conjugating... 40 0.035 UniRef50_Q9H8T0 Cluster: Fused toes protein homolog; n=36; Deute... 40 0.035 UniRef50_Q4TYX9 Cluster: Ubiquitinating enzyme; n=4; core eudico... 39 0.047 UniRef50_Q5KPI9 Cluster: Expressed protein; n=2; Filobasidiella ... 39 0.047 UniRef50_Q5KFD4 Cluster: Ubiquitin-conjugating enzyme E2-28.4KD,... 39 0.047 UniRef50_UPI00006CBBED Cluster: Ubiquitin-conjugating enzyme fam... 39 0.062 UniRef50_Q54FR5 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 39 0.062 UniRef50_Q235M6 Cluster: Ubiquitin-conjugating enzyme family pro... 39 0.062 UniRef50_UPI0000499F8B Cluster: ubiquitin-conjugating enzyme; n=... 38 0.081 UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, w... 38 0.081 UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E... 38 0.081 UniRef50_Q0V191 Cluster: Predicted protein; n=1; Phaeosphaeria n... 38 0.11 UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-... 38 0.14 UniRef50_Q0SCN0 Cluster: Probable carbohydrate kinase; n=1; Rhod... 38 0.14 UniRef50_A7P8D5 Cluster: Chromosome chr3 scaffold_8, whole genom... 38 0.14 UniRef50_Q7RIL6 Cluster: Ubiquitin carrier protein; n=1; Plasmod... 38 0.14 UniRef50_Q17720 Cluster: Ubiquitin conjugating enzyme protein 22... 38 0.14 UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonos... 38 0.14 UniRef50_Q2UBX6 Cluster: Ubiquitin-conjugating enzyme; n=1; Aspe... 38 0.14 UniRef50_A6QWR4 Cluster: Ubiquitin carrier protein; n=1; Ajellom... 38 0.14 UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8... 38 0.14 UniRef50_UPI00006CFADA Cluster: Ubiquitin-conjugating enzyme fam... 37 0.19 UniRef50_Q7Y014 Cluster: Putative ubiquitin-conjugating enzyme, ... 37 0.19 UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative;... 37 0.19 UniRef50_A0C227 Cluster: Chromosome undetermined scaffold_143, w... 37 0.19 UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 37 0.19 UniRef50_UPI00006A048D Cluster: MGC89818 protein.; n=2; Tetrapod... 37 0.25 UniRef50_A7DVL7 Cluster: Dinucleotide-utilizing enzymes; n=1; Vi... 37 0.25 UniRef50_Q5NAX2 Cluster: Ubiquitin-conjugating enzyme-like; n=7;... 37 0.25 UniRef50_A3AAU2 Cluster: Putative uncharacterized protein; n=3; ... 37 0.25 UniRef50_A2FTA9 Cluster: Ubiquitin-conjugating enzyme family pro... 37 0.25 UniRef50_A0BPF8 Cluster: Chromosome undetermined scaffold_12, wh... 37 0.25 UniRef50_Q0DY15 Cluster: Os02g0721200 protein; n=2; Oryza sativa... 36 0.33 UniRef50_Q4DY64 Cluster: Ubiquitin-conjugating enzyme E2, putati... 36 0.33 UniRef50_Q4DQ89 Cluster: Ubiquitin-conjugating enzyme, putative;... 36 0.33 UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscu... 36 0.33 UniRef50_A5K8U0 Cluster: Ubiquitin-conjugating enzyme domain con... 36 0.33 UniRef50_A4QZB9 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 0.33 UniRef50_Q10MI2 Cluster: Ubiquitinating enzyme, putative, expres... 36 0.43 UniRef50_Q0WM96 Cluster: Ubiquitin-conjugating enzyme E2-like pr... 36 0.43 UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=... 36 0.57 UniRef50_Q4N4K0 Cluster: Ubiquitin-protein ligase, putative; n=3... 36 0.57 UniRef50_Q22YU9 Cluster: Ubiquitin-conjugating enzyme family pro... 36 0.57 UniRef50_A7AUL3 Cluster: Ubiquitin-conjugating enzyme E2; n=1; B... 36 0.57 UniRef50_Q9H832 Cluster: Ubiquitin-conjugating enzyme E2 Z; n=32... 36 0.57 UniRef50_Q8N2K1 Cluster: Ubiquitin-conjugating enzyme E2 J2; n=3... 36 0.57 UniRef50_Q4DDS1 Cluster: Ubiquitin-conjugating enzyme E2, putati... 35 0.76 UniRef50_Q4WZL9 Cluster: Ubiquitin conjugating enzyme (UbcF), pu... 35 0.76 UniRef50_Q2HAD1 Cluster: Putative uncharacterized protein; n=1; ... 35 0.76 UniRef50_Q9AWU5 Cluster: P0044F08.17 protein; n=4; Oryza sativa|... 35 1.0 UniRef50_Q615T3 Cluster: Putative uncharacterized protein CBG154... 35 1.0 UniRef50_Q4Q3B5 Cluster: Ubiquitin-conjugating enzyme E2, putati... 35 1.0 UniRef50_A7SJX4 Cluster: Predicted protein; n=1; Nematostella ve... 35 1.0 UniRef50_Q0UCY4 Cluster: Putative uncharacterized protein; n=1; ... 35 1.0 UniRef50_A7RKM3 Cluster: Predicted protein; n=2; Nematostella ve... 34 1.3 UniRef50_Q11076 Cluster: Probable ubiquitin-conjugating enzyme p... 34 1.3 UniRef50_Q0RSE1 Cluster: Putative uncharacterized protein; n=1; ... 34 1.8 UniRef50_Q5GAR9 Cluster: Uce2; n=6; Poaceae|Rep: Uce2 - Zea mays... 34 1.8 UniRef50_Q4QAG0 Cluster: Ubiquitin-conjugating enzyme E2, putati... 34 1.8 UniRef50_A0DZ21 Cluster: Chromosome undetermined scaffold_7, who... 34 1.8 UniRef50_A0DQA2 Cluster: Chromosome undetermined scaffold_6, who... 34 1.8 UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; ... 34 1.8 UniRef50_A2E0M6 Cluster: Ubiquitin-conjugating enzyme family pro... 33 2.3 UniRef50_UPI000023E1A1 Cluster: hypothetical protein FG04396.1; ... 33 3.1 UniRef50_Q6ZGB6 Cluster: Kelch repeat-containing F-box family pr... 33 3.1 UniRef50_A0EG13 Cluster: Chromosome undetermined scaffold_94, wh... 33 3.1 UniRef50_A0C0Q6 Cluster: Chromosome undetermined scaffold_140, w... 33 3.1 UniRef50_A2QB39 Cluster: Similarity: N-terminal to ubiquitin-con... 33 3.1 UniRef50_Q00WE4 Cluster: Ubiquitin-protein ligase; n=1; Ostreoco... 33 4.1 UniRef50_Q60VN4 Cluster: Putative uncharacterized protein CBG194... 33 4.1 UniRef50_Q5CVJ2 Cluster: Ubc6p like ubiquiting conjugating enzym... 33 4.1 UniRef50_Q54U33 Cluster: Putative uncharacterized protein; n=1; ... 33 4.1 UniRef50_A0DAS7 Cluster: Chromosome undetermined scaffold_43, wh... 33 4.1 UniRef50_O42646 Cluster: Ubiquitin-conjugating enzyme E2 6; n=2;... 33 4.1 UniRef50_Q9FK29 Cluster: Ubiquitin conjugating enzyme-like prote... 32 5.4 UniRef50_Q017C9 Cluster: Non-Canonical UBiquitin Conjugating Enz... 32 5.4 UniRef50_Q583Z6 Cluster: Ubiquitin-conjugating enzyme E2, putati... 32 5.4 UniRef50_Q54LP7 Cluster: Putative uncharacterized protein; n=2; ... 32 5.4 UniRef50_Q4DI07 Cluster: Putative uncharacterized protein; n=2; ... 32 5.4 UniRef50_Q1JSQ0 Cluster: Ubiquitin conjugating enzyme 2, putativ... 32 5.4 UniRef50_A7SGQ2 Cluster: Predicted protein; n=2; Nematostella ve... 32 5.4 UniRef50_A0C8X8 Cluster: Chromosome undetermined scaffold_159, w... 32 5.4 UniRef50_Q2H0K6 Cluster: Putative uncharacterized protein; n=1; ... 32 5.4 UniRef50_Q0TZD5 Cluster: Putative uncharacterized protein; n=4; ... 32 5.4 UniRef50_Q0CVJ2 Cluster: Palmitoyltransferase PFA3; n=3; Aspergi... 32 5.4 UniRef50_UPI0000DB6D56 Cluster: PREDICTED: similar to CG32778-PA... 32 7.1 UniRef50_Q24R21 Cluster: Putative uncharacterized protein; n=2; ... 32 7.1 UniRef50_Q7R415 Cluster: GLP_68_18546_19520; n=1; Giardia lambli... 32 7.1 UniRef50_A2G9D2 Cluster: Putative uncharacterized protein; n=1; ... 32 7.1 UniRef50_A2AKC6 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=4... 31 9.4 UniRef50_A0JXG9 Cluster: Cyclopropane-fatty-acyl-phospholipid sy... 31 9.4 UniRef50_A1ZBR5 Cluster: CG16894-PA; n=3; Sophophora|Rep: CG1689... 31 9.4 UniRef50_Q4X016 Cluster: Ubiquitin conjugating enzyme, putative;... 31 9.4 UniRef50_Q9C0C9 Cluster: Ubiquitin-conjugating enzyme E2 O; n=26... 31 9.4 UniRef50_P33296 Cluster: Ubiquitin-conjugating enzyme E2 6; n=9;... 31 9.4 UniRef50_Q5UQ57 Cluster: Probable ubiquitin-conjugating enzyme E... 31 9.4 UniRef50_Q9Y385 Cluster: Ubiquitin-conjugating enzyme E2 J1; n=3... 31 9.4 UniRef50_Q9NR09 Cluster: Baculoviral IAP repeat-containing prote... 31 9.4 >UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 H - Homo sapiens (Human) Length = 183 Score = 196 bits (479), Expect = 1e-49 Identities = 85/96 (88%), Positives = 90/96 (93%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q TPYEGGVW+VRV LPD YPFKSPSIGFMNK++HPNIDE SGTVCLDVINQ WTALYDL Sbjct: 42 QGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDL 101 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 +NIFESFLPQLL YPNPIDPLNGDAAAMYLH+PEEY Sbjct: 102 TNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEY 137 Score = 59.7 bits (138), Expect = 3e-08 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +3 Query: 72 GNDAWHTDVIKLIESKHEVTILSGLNEFCVKFFGPPG 182 G TDV+KLIESKHEVTIL GLNEF VKF+GP G Sbjct: 7 GKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQG 43 >UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorhabditis elegans|Rep: Ubiquitin carrier protein - Caenorhabditis elegans Length = 221 Score = 180 bits (439), Expect = 1e-44 Identities = 75/94 (79%), Positives = 86/94 (91%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YE GVWR+RV +PD YPFKSPSIGF+NK++HPNIDE SGTVCLDVINQAWTALYDL+N Sbjct: 45 TAYENGVWRIRVDMPDKYPFKSPSIGFLNKIFHPNIDEASGTVCLDVINQAWTALYDLTN 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IF++FLPQLLTYPN DPLNG+AA +Y+HKPEEY Sbjct: 105 IFDTFLPQLLTYPNAADPLNGEAARLYIHKPEEY 138 Score = 41.5 bits (93), Expect = 0.009 Identities = 19/41 (46%), Positives = 25/41 (60%) Frame = +3 Query: 66 ALGNDAWHTDVIKLIESKHEVTILSGLNEFCVKFFGPPGNA 188 A+G DV+KLI HEV I++G +EF V+F GP A Sbjct: 6 AIGKRRIDCDVVKLISHNHEVQIVNGCSEFIVRFHGPKDTA 46 >UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizomycotina|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 257 Score = 159 bits (387), Expect = 2e-38 Identities = 65/94 (69%), Positives = 80/94 (85%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +P+ GG+W+V V LPD YP+KSPSIGF+N++YHPNIDE+SG+VCLDVINQ W+ +YD+ N Sbjct: 114 SPFAGGLWKVHVELPDQYPYKSPSIGFVNRIYHPNIDELSGSVCLDVINQTWSPMYDMIN 173 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IFE FLPQLL YPNP DPLNGDAAA+ L P +Y Sbjct: 174 IFEVFLPQLLRYPNPSDPLNGDAAAVLLRDPSKY 207 >UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukaryota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 372 Score = 158 bits (383), Expect = 6e-38 Identities = 63/96 (65%), Positives = 81/96 (84%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 ++ P+ GGVW++ V LPD YP+KSPSIGFMNK++HPNIDE+SG+VCLDVINQ W+ ++D Sbjct: 226 RLAPFAGGVWKIHVELPDQYPYKSPSIGFMNKIFHPNIDELSGSVCLDVINQTWSPMFDC 285 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 NIFE FLPQLL YPNP DPLNG+AAA+ + +P+ Y Sbjct: 286 INIFEVFLPQLLRYPNPTDPLNGEAAALLMREPKTY 321 >UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 185 Score = 155 bits (376), Expect = 4e-37 Identities = 65/94 (69%), Positives = 78/94 (82%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY GG W+VRV LP YP+KSPSIGF NK+YHPN+D SG+VCLDVINQ W+ ++DL N Sbjct: 42 SPYFGGCWKVRVELPPAYPYKSPSIGFTNKIYHPNVDLASGSVCLDVINQTWSPMFDLIN 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IFE FLPQLL YPNP DPLNG+AA+M L +PE+Y Sbjct: 102 IFEIFLPQLLLYPNPTDPLNGEAASMLLKEPEKY 135 >UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoidasida|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 191 Score = 152 bits (368), Expect = 4e-36 Identities = 65/94 (69%), Positives = 74/94 (78%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YEGG+W+V V LPD YPF SPSIGFMNK+ HPN+DE SG+VCLDVINQ WT LY L N Sbjct: 44 TAYEGGIWKVHVTLPDDYPFASPSIGFMNKLLHPNVDEASGSVCLDVINQTWTPLYSLVN 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 +FE FLPQLLTYPNP DPLN DAA++ + Y Sbjct: 104 VFEVFLPQLLTYPNPSDPLNSDAASLLMKDKNIY 137 >UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 256 Score = 149 bits (360), Expect = 4e-35 Identities = 64/94 (68%), Positives = 74/94 (78%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YE GVW+V V LP YP+KSPSIGF NK++HPNID SG+VCLDVINQ W ++DL N Sbjct: 108 TAYESGVWKVNVELPVEYPYKSPSIGFANKIFHPNIDLQSGSVCLDVINQTWKPMFDLVN 167 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IFE FLPQLLTYPNP DPLN DAAA+ + P+ Y Sbjct: 168 IFEVFLPQLLTYPNPSDPLNADAAALSMKDPQTY 201 >UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa 3; n=10; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-21 kDa 3 - Arabidopsis thaliana (Mouse-ear cress) Length = 183 Score = 149 bits (360), Expect = 4e-35 Identities = 58/92 (63%), Positives = 76/92 (82%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GGVW+++V LP+ YP+KSPS+GF+NK+YHPN+DE SG VCLDVINQ W+ ++DL N+F Sbjct: 44 YQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVF 103 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ESFLPQLL YPNP DP NG+AA++ + Y Sbjct: 104 ESFLPQLLLYPNPSDPFNGEAASLLMRDRAAY 135 >UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa; n=8; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-23 kDa - Triticum aestivum (Wheat) Length = 184 Score = 149 bits (360), Expect = 4e-35 Identities = 61/92 (66%), Positives = 76/92 (82%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GGVW+VRV L + YP+KSPSIGF NK+YHPN+DE+SG+VCLDVINQ W+ ++DL NIF Sbjct: 44 YQGGVWKVRVELTEAYPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIF 103 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 E FLPQLL YPNP DPLNG+AA++ + Y Sbjct: 104 EVFLPQLLLYPNPSDPLNGEAASLMMRDKNAY 135 >UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 234 Score = 137 bits (331), Expect = 1e-31 Identities = 60/89 (67%), Positives = 68/89 (76%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G W + V LP YPFKSPSIGF N++ HPN+DE SG+VCLDVINQ WT +Y L N Sbjct: 46 TPYEDGTWMLHVQLPSDYPFKSPSIGFCNRILHPNVDERSGSVCLDVINQTWTPMYQLEN 105 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 IF+ FLPQLL YPNP DPLN AA + LH Sbjct: 106 IFDVFLPQLLRYPNPSDPLNVQAAHL-LH 133 >UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 223 Score = 134 bits (323), Expect = 1e-30 Identities = 57/94 (60%), Positives = 69/94 (73%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G WR+ V LPD+YP+KSPSIGF+NK++HPNID SG++CLDVIN W+ LYDL N Sbjct: 43 TPYENGCWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLN 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I E +P LL PN DPLN +AA + LH Y Sbjct: 103 IVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLY 136 Score = 33.9 bits (74), Expect = 1.8 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 90 TDVIKLIESKHEVTILS-GLNEFCVKFFGPPGNAIRRWC 203 TDV+KL+ S H+V +++ + EF VKF GP C Sbjct: 11 TDVMKLLMSDHDVELVNDNMQEFYVKFCGPKDTPYENGC 49 >UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 171 Score = 133 bits (322), Expect = 2e-30 Identities = 54/94 (57%), Positives = 73/94 (77%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY G + V + LPD+YPFKSPSIGF +++HPN+DE SG++CLDV+NQ W+ +YDL N Sbjct: 42 SPYSGAKYIVNILLPDNYPFKSPSIGFTTRIFHPNVDEASGSICLDVLNQIWSPIYDLLN 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + LPQLL+YPN DPLN +A +MYL+ E+Y Sbjct: 102 IVDILLPQLLSYPNAADPLNCEAGSMYLNNREKY 135 >UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 218 Score = 133 bits (322), Expect = 2e-30 Identities = 57/94 (60%), Positives = 70/94 (74%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE GVWR+ V LPD+YP+KSPSIGF+NK++HPNID SG++CLDVIN W+ LYDL N Sbjct: 42 TPYENGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLIN 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I E +P LL PN DPLN +AA + L + Y Sbjct: 102 IVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLY 135 Score = 33.5 bits (73), Expect = 2.3 Identities = 15/30 (50%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Frame = +3 Query: 90 TDVIKLIESKHEVTILS-GLNEFCVKFFGP 176 TDV+KL+ S H+V +++ + EF VKF GP Sbjct: 10 TDVMKLLMSDHQVDLINDSMQEFHVKFLGP 39 >UniRef50_UPI00015B5920 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2; n=2; Endopterygota|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme h isoform 2 - Nasonia vitripennis Length = 156 Score = 86.6 bits (205), Expect(2) = 2e-28 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +1 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY Sbjct: 69 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 106 Score = 61.3 bits (142), Expect(2) = 2e-28 Identities = 23/29 (79%), Positives = 26/29 (89%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMN 270 TPYEGG+W+VRVHLP+HYPFKSPSI N Sbjct: 44 TPYEGGIWKVRVHLPEHYPFKSPSIDLSN 72 Score = 59.7 bits (138), Expect = 3e-08 Identities = 28/37 (75%), Positives = 29/37 (78%) Frame = +3 Query: 72 GNDAWHTDVIKLIESKHEVTILSGLNEFCVKFFGPPG 182 G TDVIKLIESKHEVTIL GLNEF VKF+GP G Sbjct: 7 GKRRMDTDVIKLIESKHEVTILGGLNEFSVKFYGPRG 43 >UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG14739-PA - Drosophila melanogaster (Fruit fly) Length = 206 Score = 117 bits (281), Expect = 1e-25 Identities = 48/90 (53%), Positives = 65/90 (72%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEGG+W V V +P YP +P + F+ K+ HPNI+ ++G VC++V+ QAW++ YDL NIF Sbjct: 53 YEGGIWTVNVTMPQDYPLTAPRVRFVTKILHPNIEFITGLVCMNVLKQAWSSSYDLVNIF 112 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 E+FLPQLL YPNP D LN AAA+ H + Sbjct: 113 ETFLPQLLRYPNPHDSLNHRAAAIMKHSEQ 142 >UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 309 Score = 97.9 bits (233), Expect = 1e-19 Identities = 48/88 (54%), Positives = 59/88 (67%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G W V V +P+ YP+KSPSIG +VCLDVINQ W+ +Y+L N Sbjct: 59 TPYEEGSWEVYVLIPEQYPYKSPSIG---------------SVCLDVINQTWSPMYELIN 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL 447 IF+ FLPQLLTYPNP DPLN +AA + + Sbjct: 104 IFDIFLPQLLTYPNPKDPLNPEAAMILI 131 >UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 272 Score = 92.3 bits (219), Expect = 5e-18 Identities = 37/94 (39%), Positives = 60/94 (63%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG + V + +P+ YPF+ P + F+ KV+HPN+ +G +CLD ++ AW+ + + + Sbjct: 47 TPYEGGTYEVDIKIPNDYPFRPPVMKFVTKVWHPNVSSQTGAICLDTLSSAWSPVLTIKS 106 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S L LL+ P P DP + + A M L +P+E+ Sbjct: 107 ALLS-LQSLLSTPEPKDPQDAEVATMLLRRPKEF 139 >UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermatophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 284 Score = 90.6 bits (215), Expect = 1e-17 Identities = 40/94 (42%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY GGV+ V +H P YPFK P + F KVYHPNI+ +G++CLD++ + W+ +S Sbjct: 43 SPYAGGVFFVNIHFPPDYPFKPPKVNFQTKVYHPNINS-NGSICLDILKEQWSPALTISK 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LLT PNP DPL + A +Y + Y Sbjct: 102 VLLS-ISSLLTDPNPDDPLVPEIAHVYKSQRPRY 134 >UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Arabidopsis thaliana (Mouse-ear cress) Length = 148 Score = 89.8 bits (213), Expect = 3e-17 Identities = 40/94 (42%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY GGV+ V +H P YPFK P + F KV+HPNI+ +G++CLD++ + W+ +S Sbjct: 43 SPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS-NGSICLDILKEQWSPALTISK 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LLT PNP DPL + A MY +Y Sbjct: 102 VLLS-ICSLLTDPNPDDPLVPEIAHMYKTDKNKY 134 >UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 215 Score = 89.0 bits (211), Expect = 4e-17 Identities = 41/94 (43%), Positives = 55/94 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG + V + +P YPFK P + F KVYHPNI V+G +CLD++ AW+ + L + Sbjct: 45 TPYEGGKFVVDIEVPMEYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKS 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S L LL P P DP + + A YL E + Sbjct: 105 ALIS-LQALLQSPEPNDPQDAEVAQHYLRDRESF 137 >UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryota|Rep: Ubiquitin carrier protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 147 Score = 87.8 bits (208), Expect = 1e-16 Identities = 38/94 (40%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY+GGV+ + +H P YPFK P + F K+YHPNI+ +G++CLD++ W+ +S Sbjct: 43 SPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSK 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP DPL D A +Y ++Y Sbjct: 102 VLLS-ICSLLCDPNPDDPLVPDIAHIYKSDKDKY 134 >UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 146 Score = 87.0 bits (206), Expect = 2e-16 Identities = 40/92 (43%), Positives = 56/92 (60%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GGV+ + VH P YPFK P I F K+YHPNI+ +G++CLD++ W+ +S + Sbjct: 44 YQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINS-NGSICLDILRSQWSPALTVSKVL 102 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + LL PNP DPL D A +Y E+Y Sbjct: 103 LS-ICSLLCDPNPDDPLVPDIAQIYKSDKEKY 133 >UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_18, whole genome shotgun sequence - Paramecium tetraurelia Length = 562 Score = 86.6 bits (205), Expect = 2e-16 Identities = 38/94 (40%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+E G++++ +P YPFK P I F K++HPNI + SG VCLDV+ W+ + + Sbjct: 421 TPFENGIYQLTCVIPQDYPFKPPKISFFTKMHHPNISKASGAVCLDVLKDQWSPALSVFS 480 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP D L+ + AA Y H+ Y Sbjct: 481 VLLS-IRSLLIDPNPDDALDSNVAAEYKHEKALY 513 >UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b; n=2; Amniota|Rep: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b - Monodelphis domestica Length = 270 Score = 86.2 bits (204), Expect = 3e-16 Identities = 37/94 (39%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY+GGV+ + +H P YPFK P + F ++YHPNI+ +G++CLD++ W+ +S Sbjct: 166 SPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISK 224 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP DPL + A +Y E+Y Sbjct: 225 VLLS-ICSLLCDPNPDDPLVPEIARIYKTDREKY 257 >UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2); n=169; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) - Homo sapiens (Human) Length = 147 Score = 86.2 bits (204), Expect = 3e-16 Identities = 37/94 (39%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY+GGV+ + +H P YPFK P + F ++YHPNI+ +G++CLD++ W+ +S Sbjct: 43 SPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTISK 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP DPL + A +Y E+Y Sbjct: 102 VLLS-ICSLLCDPNPDDPLVPEIARIYKTDREKY 134 >UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=30; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 85.4 bits (202), Expect = 5e-16 Identities = 36/87 (41%), Positives = 56/87 (64%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +P+EGGV+++ + LP+ YP +P + F+ K+YHPNID + G +CLDV+ W+ + Sbjct: 45 SPFEGGVFKLELFLPEDYPMSAPKVRFITKIYHPNIDRL-GRICLDVLKDKWSPALQIRT 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 I S + LL+ PNP DPL D A ++ Sbjct: 104 ILLS-IQALLSAPNPDDPLANDVAELW 129 >UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)); n=43; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)) - Homo sapiens (Human) Length = 200 Score = 85.4 bits (202), Expect = 5e-16 Identities = 36/94 (38%), Positives = 53/94 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG +++ + +P+ YPF P + F+ K++HPNI V+G +CLD++ W A L Sbjct: 49 TPYEGGRYQLEIKIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRT 108 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S L LL P DP + A Y PE + Sbjct: 109 VLLS-LQALLAAAEPDDPQDAVVANQYKQNPEMF 141 >UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomycota|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 223 Score = 85.0 bits (201), Expect = 7e-16 Identities = 37/94 (39%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY +++ P +YP+ P++ F +YHPN+D SG +CLD++ WTA Y++ Sbjct: 118 TPYASKQFKLSFAFPSNYPYAPPTVLFKTPIYHPNVD-FSGRICLDILKDKWTAAYNIQT 176 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S L LL PN PLNG+AA ++ PEE+ Sbjct: 177 VLLS-LQSLLGEPNNASPLNGEAAELWDKNPEEF 209 >UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo sapiens (Human) Length = 152 Score = 85.0 bits (201), Expect = 7e-16 Identities = 35/94 (37%), Positives = 57/94 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+E G +++ + + YP K P++ F++K++HPN+ G++CLD++ W+ YD+S+ Sbjct: 46 TPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNV-YADGSICLDILQNRWSPTYDVSS 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LL PNP P N AA +Y EY Sbjct: 105 ILTS-IQSLLDEPNPNSPANSQAAQLYQENKREY 137 >UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=123; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 N - Homo sapiens (Human) Length = 152 Score = 84.6 bits (200), Expect = 9e-16 Identities = 34/89 (38%), Positives = 56/89 (62%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q +P+EGG +++ + LP+ YP +P + FM K+YHPN+D++ G +CLD++ W+ + Sbjct: 43 QDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKL-GRICLDILKDKWSPALQI 101 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + S + LL+ PNP DPL D A + Sbjct: 102 RTVLLS-IQALLSAPNPDDPLANDVAEQW 129 >UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 197 Score = 83.8 bits (198), Expect = 2e-15 Identities = 33/94 (35%), Positives = 58/94 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG++++ + +P YP++ P + F+ +++HPNI +G +CLD++ AW+ L Sbjct: 49 TPYEGGIFQLDIIVPKEYPYEPPKVKFITRIWHPNISSQTGAICLDILKDAWSPALTLRT 108 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL+ P P DP + A++Y +EY Sbjct: 109 VMLS-IQALLSSPEPNDPQDALVASLYKSDYQEY 141 >UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=93; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 83.8 bits (198), Expect = 2e-15 Identities = 36/94 (38%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+E G +++ + + YP K P++ F++KV+HPN+ G +CLD++ W+ YD+S Sbjct: 46 TPFEDGTFKLTIEFTEEYPNKPPTVRFVSKVFHPNV-YADGGICLDILQNRWSPTYDVSA 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LL+ PNP P N AA +Y EY Sbjct: 105 ILTS-IQSLLSDPNPNSPANSTAAQLYKENRREY 137 >UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=6; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 156 Score = 83.0 bits (196), Expect = 3e-15 Identities = 39/94 (41%), Positives = 59/94 (62%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY G ++V + P +YPF P I F++ ++HPN+D+ SG +CLD++ + W+A+Y++ Sbjct: 51 TPYSGLKFKVSLKFPQNYPFHPPMIKFLSPMWHPNVDK-SGNICLDILKEKWSAVYNVET 109 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S L LL PN PLN AA ++ EEY Sbjct: 110 ILLS-LQSLLGEPNNRSPLNAVAAELWDADMEEY 142 >UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 192 Score = 82.6 bits (195), Expect = 4e-15 Identities = 35/88 (39%), Positives = 51/88 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG +++ + +PD YPF+ P + F KV+HPNI SG +CLD++ W+ L Sbjct: 45 TPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLDILKDQWSPALTLKT 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL 447 S + LL+ P P DP + A Y+ Sbjct: 105 ALVS-IQALLSAPEPKDPQDAVVAEQYM 131 >UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukaryota|Rep: Ubiquitin carrier protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 194 Score = 82.2 bits (194), Expect = 5e-15 Identities = 36/94 (38%), Positives = 53/94 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG +++ + L D YPF+ P + F KV+HPNI SG +CLD++ W+ L Sbjct: 45 TPYEGGTFKIDITLTDGYPFEPPKMKFATKVWHPNISSQSGAICLDILKDQWSPALTLKT 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + LL+ P P DP + A YL + + + Sbjct: 105 ALLS-IQALLSAPEPDDPQDAVVAQQYLREHQTF 137 >UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 157 Score = 81.4 bits (192), Expect = 9e-15 Identities = 30/83 (36%), Positives = 54/83 (65%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGGV+++ +P+ YP + P + F+ K++HPN+ +G +CLD++ AW+ + L + Sbjct: 47 TPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQS 106 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + + L+ +P P PLN D+ Sbjct: 107 VCRAII-ALMAHPEPDSPLNCDS 128 >UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=3; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 161 Score = 80.6 bits (190), Expect = 2e-14 Identities = 39/94 (41%), Positives = 56/94 (59%), Gaps = 1/94 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN-QAWTALYDLS 360 TPYEGG + + V LP++YP+ P I F KVYHPNI G +CLD + Q W +S Sbjct: 54 TPYEGGKFALDVFLPENYPYSPPVIKFATKVYHPNI-SFFGKICLDTLKPQGWVCAMQIS 112 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEE 462 ++ ++ + QLL PN DPLN + ++L P + Sbjct: 113 SVLQT-IQQLLANPNLEDPLNLEVNNLWLSNPAQ 145 >UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 195 Score = 80.6 bits (190), Expect = 2e-14 Identities = 37/90 (41%), Positives = 51/90 (56%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q TPYEGG + + + LP YPF+ P + F+ KV+HPNI +G +CLD++ W+ L Sbjct: 44 QGTPYEGGTFVIDIRLPGGYPFEPPKMQFITKVWHPNISSQNGAICLDILKDQWSPALTL 103 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYL 447 S L LL+ P P DP + A YL Sbjct: 104 KTALLS-LQALLSAPAPDDPQDAVVAQQYL 132 >UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 260 Score = 80.6 bits (190), Expect = 2e-14 Identities = 39/87 (44%), Positives = 52/87 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGGV+ V + +P YPF P + FM KVYH N+ +G +CLD++ AW+ L Sbjct: 53 SPYEGGVFDVDIRVPHDYPFSPPHLQFMTKVYHCNVAS-NGAICLDLLKTAWSPALSLYK 111 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 + S L LLT PNP DPL A+ Y Sbjct: 112 VILS-LSSLLTDPNPADPLVPPIASEY 137 >UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 167 Score = 80.2 bits (189), Expect = 2e-14 Identities = 30/86 (34%), Positives = 57/86 (66%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q +P+E G+++++V +P +YP +P++ F +++HPN+ +G VCL+V++Q W + + Sbjct: 42 QDSPFEDGIFKIKVSIPSNYPISAPTLHFQTRIFHPNVHMDTGEVCLEVLSQKWEPRWTI 101 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAA 435 ++ + + +L PNP PLN DAA Sbjct: 102 ESVLRA-VRLMLQEPNPYSPLNCDAA 126 >UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2; n=3; Coelomata|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2 - Nasonia vitripennis Length = 176 Score = 79.8 bits (188), Expect = 3e-14 Identities = 37/92 (40%), Positives = 52/92 (56%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEGGV+ + +H YPFK P + F ++YH NI+ G +CLD++ W+ +S + Sbjct: 74 YEGGVFFLDIHFSPEYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL 132 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + LLT NP DPL G A YL EE+ Sbjct: 133 LS-ICSLLTDCNPADPLVGSIATQYLQNREEH 163 >UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 585 Score = 79.8 bits (188), Expect = 3e-14 Identities = 36/96 (37%), Positives = 56/96 (58%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q +PY G++ + V+ PD+YP +P I F+ K+YH NI+ G +CLD++ +W+ + Sbjct: 466 QQSPYHKGLFALSVNFPDNYPMSAPKIRFLTKIYHCNINN-DGNICLDILKDSWSPALTI 524 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + S + QLL PNP DPL+ A +Y Y Sbjct: 525 SKVMLS-ISQLLVTPNPHDPLDVVKAGVYRDDVNNY 559 >UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichocomaceae|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 530 Score = 79.4 bits (187), Expect = 4e-14 Identities = 32/88 (36%), Positives = 52/88 (59%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q TPY G+WR+ + +P+ YP P F +++HPN++E +G VC+D + + W + L Sbjct: 147 QGTPYSQGLWRLHLKMPEDYPKSPPKATFKTRIWHPNVEESTGAVCVDTLKRDWKSTLTL 206 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAM 441 ++ + + LL YPNP LN A A+ Sbjct: 207 KDVLVT-ISCLLIYPNPDSALNSTAGAL 233 >UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; Dikarya|Rep: NEDD8-conjugating enzyme ubc12 - Schizosaccharomyces pombe (Fission yeast) Length = 177 Score = 79.4 bits (187), Expect = 4e-14 Identities = 38/88 (43%), Positives = 56/88 (63%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GG ++ R+ + D+YP P + +NK+YHPNID + G VCL+++ Q W + +L++I Sbjct: 65 YKGGKFKFRIQIDDNYPHDPPKVKCLNKIYHPNID-IEGNVCLNILRQDWNPVLNLNSIL 123 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHK 453 L L PN DPLN +AAA LHK Sbjct: 124 VG-LQFLFLSPNAEDPLNKEAAA-DLHK 149 >UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 196 Score = 78.6 bits (185), Expect = 6e-14 Identities = 36/94 (38%), Positives = 57/94 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+EG V R+ + YP K P++ + K++HPNI +G +CLD+++ WT +S Sbjct: 51 TPWEGAVIRLELKFTSEYPTKPPAVKVLTKMFHPNIFN-NGNICLDLLSTKWTPALGVSA 109 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LLT PNP+ P N +AAA++++ Y Sbjct: 110 ILLS-IQSLLTDPNPMSPANNEAAALFVNDRHTY 142 >UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 549 Score = 78.6 bits (185), Expect = 6e-14 Identities = 37/94 (39%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG + + V P+ YPF P + F N++YH NI+ G +CLD++ W+A Sbjct: 433 TPYEGGHFVLSVQFPNIYPFAPPKVRFENRIYHCNIN-TDGNICLDILKDHWSAAITTEK 491 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL+ PNP+DPL+ A +Y EY Sbjct: 492 VLLS-IHSLLSNPNPMDPLDVVKAGIYRDNITEY 524 >UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 175 Score = 78.6 bits (185), Expect = 6e-14 Identities = 35/92 (38%), Positives = 55/92 (59%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GG++++ + + YPFK P I F +YHPNI+ SG +C+D++ + W+ L+++ Sbjct: 70 YKGGIFKLLITFSNEYPFKPPKITFQTPIYHPNINS-SGMICIDILGKEWSPALTLNSVL 128 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S L LL PN DPL + A +Y EEY Sbjct: 129 LSLL-TLLDDPNADDPLRPEVADIYKTNKEEY 159 >UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T); n=1; Tribolium castaneum|Rep: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) - Tribolium castaneum Length = 151 Score = 78.2 bits (184), Expect = 8e-14 Identities = 39/98 (39%), Positives = 57/98 (58%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA----WTALY 351 TPY+ G+++V + +P+ YPF PSI F+ KVYHPNID+ +G +CLD+I W Sbjct: 43 TPYKNGIFKVEILIPEKYPFIPPSIKFITKVYHPNIDD-NGRICLDLIKMPPKGNWRPTI 101 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L + + + LL PNP DPL + A Y + E+ Sbjct: 102 GLEGLLIA-IRMLLETPNPEDPLMAEIAEEYRNMNSEF 138 >UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichocomaceae|Rep: Ubiquitin carrier protein - Emericella nidulans (Aspergillus nidulans) Length = 488 Score = 78.2 bits (184), Expect = 8e-14 Identities = 32/88 (36%), Positives = 52/88 (59%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q TPY G+WR+ + LP+ YP P F +++HPN++E +G VC+D + + W + L Sbjct: 86 QGTPYSQGLWRLHLKLPEDYPKSPPKATFKTRIWHPNVEESTGAVCVDTLKRDWKSTLTL 145 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAM 441 ++ + + LL +PNP LN A A+ Sbjct: 146 KDVLIT-ISCLLIFPNPDSALNATAGAL 172 >UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 77.8 bits (183), Expect = 1e-13 Identities = 35/94 (37%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +E G +R+ V+ P YPFK+PS+ F+ K+YHPNI G +CLD++ W Y++++ Sbjct: 43 TIWENGHFRLTVNFPSEYPFKAPSVKFITKIYHPNISSTGG-ICLDLLIDKWLPSYNVAS 101 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + L PNP LN +A M+ + + Y Sbjct: 102 LLVS-IRSFLDDPNPEHGLNSEALEMFRNNKDGY 134 >UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similarities with DEHA0D15444g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 153 Score = 77.8 bits (183), Expect = 1e-13 Identities = 32/84 (38%), Positives = 54/84 (64%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YE G+W+V +++P++YP + P++ F K+ HPNI +G VC+DV+ W+ + +S+ Sbjct: 45 TAYENGLWQVEINIPENYPLQPPTMFFRTKICHPNIHFETGEVCIDVLKTQWSPAWTISS 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAA 435 + + +L+ P P PLN DAA Sbjct: 105 ACTA-VSAMLSLPEPDSPLNIDAA 127 >UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16; Coelomata|Rep: Ubiquitin-conjugating enzyme E2 T - Homo sapiens (Human) Length = 197 Score = 77.8 bits (183), Expect = 1e-13 Identities = 38/96 (39%), Positives = 60/96 (62%), Gaps = 5/96 (5%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI----NQAWTALY 351 TPYE GV+++ V +P+ YPF+ P I F+ +YHPNID +G +CLDV+ AW Sbjct: 44 TPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDS-AGRICLDVLKLPPKGAWRPSL 102 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMY-LHKP 456 +++ + S + L++ PNP DPL D ++ + +KP Sbjct: 103 NIATVLTS-IQLLMSEPNPDDPLMADISSEFKYNKP 137 >UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 720 Score = 77.4 bits (182), Expect = 1e-13 Identities = 35/94 (37%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+EGG + +++ + YP K P + F +YHPN+ G +CLD++ + WT + D+ Sbjct: 610 TPWEGGCFELKLAFSNDYPTKPPEVRFAPPIYHPNV-YPDGRICLDILKEQWTPILDVWA 668 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LL PNP P N +AA +Y+ EY Sbjct: 669 ILTS-IRSLLCDPNPNSPANPEAAKLYMSDRAEY 701 >UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T).; n=3; Amniota|Rep: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T). - Gallus gallus Length = 158 Score = 77.0 bits (181), Expect = 2e-13 Identities = 36/96 (37%), Positives = 57/96 (59%), Gaps = 4/96 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI----NQAWTALY 351 TPYE G++ + + +P+ YPF+ P I F+ +YHPNID +G +CLDV+ AW Sbjct: 8 TPYEKGIFDLEIVVPERYPFEPPKIRFLTPIYHPNIDS-AGRICLDVLKLPPKGAWRPSL 66 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 ++S + S + L+ PNP DPL D ++ Y + + Sbjct: 67 NISTLLTS-IQLLMVEPNPDDPLMADISSEYKYNKQ 101 >UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 159 Score = 77.0 bits (181), Expect = 2e-13 Identities = 36/95 (37%), Positives = 59/95 (62%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLS 360 T +E GV+R++V ++YP + P++ F++ +YHPN+ + G +CLD++ + W +YDL Sbjct: 44 TIWEHGVFRLKVTFTNNYPAEPPAVRFLSSIYHPNVYK-DGKICLDILTKKEWKPVYDLG 102 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP DP N DAA Y++ Y Sbjct: 103 TVLTS-IRSLLCDPNPKDPANCDAAYEYIYDRHLY 136 >UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin conjugating protein, putative - Trichomonas vaginalis G3 Length = 151 Score = 77.0 bits (181), Expect = 2e-13 Identities = 35/94 (37%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +E V +V++ P YP P F+ KV+HPN+ + +CLD++ + W+ Y++S Sbjct: 44 TLWEDAVLKVKMKYPKDYPAHPPFCTFITKVFHPNVFPTTQEICLDILRRNWSPAYNVSA 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + QLLT PNP N +A +Y+H EY Sbjct: 104 ILLS-IQQLLTEPNPAANANPEACQLYIHNRSEY 136 >UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidioides immitis|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 469 Score = 77.0 bits (181), Expect = 2e-13 Identities = 31/87 (35%), Positives = 51/87 (58%) Frame = +1 Query: 181 VTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 VTPY G+WR+ + +P+ YP P F +++HPN++E +G VC+D + + W L Sbjct: 56 VTPYSQGLWRLHLRIPEDYPKSPPKAAFRTRIWHPNVEESTGAVCVDTLKRDWEPKLTLR 115 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAM 441 ++ + + LL +PNP LN A A+ Sbjct: 116 DVLIT-ISCLLIHPNPDSALNSAAGAL 141 >UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 227 Score = 76.6 bits (180), Expect = 3e-13 Identities = 34/94 (36%), Positives = 53/94 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYE G + V + +P+ YPF+ + F+ +VYHPNI SG +CLD++ W+ + L + Sbjct: 46 SPYEKGTFDVDIVVPEGYPFQPIKMKFITRVYHPNISSQSGAICLDILKDQWSPVLTLKS 105 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S L LL P P DP + + A YL ++ Sbjct: 106 TLMS-LRSLLCSPEPNDPQDAEVAKHYLRDKNDF 138 >UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 221 Score = 76.2 bits (179), Expect = 3e-13 Identities = 31/89 (34%), Positives = 53/89 (59%) Frame = +1 Query: 199 GVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESF 378 G +++ + + YP K P++ F+++++HPN+ G++CLD++ W+ YD+S+I S Sbjct: 120 GTFKLLIEFSEEYPNKPPTVRFVSRMFHPNV-YADGSICLDILQNRWSPTYDVSSILTS- 177 Query: 379 LPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + LL PNP P N AA +Y EY Sbjct: 178 IQSLLDEPNPNSPANSQAAQLYQENKREY 206 >UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezizomycotina|Rep: Ubiquitin-conjugating enzyme - Coccidioides immitis Length = 169 Score = 76.2 bits (179), Expect = 3e-13 Identities = 34/87 (39%), Positives = 51/87 (58%), Gaps = 1/87 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLS 360 TPYE G+W + + +P YP P I F ++ HPNI +G +CL ++ ++ W Y LS Sbjct: 49 TPYENGLWSLSIAIPPTYPLSPPKISFTTRICHPNISFSTGEICLSLLTSEHWAPTYTLS 108 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAM 441 + + + QLL+ P P PLN D AA+ Sbjct: 109 STLAA-IHQLLSDPRPESPLNVDVAAL 134 >UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypanosoma brucei|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 226 Score = 75.4 bits (177), Expect = 6e-13 Identities = 32/94 (34%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +EGGV+++ + P YPF PS+ F K++HPN+ +G +CLD + W + + Sbjct: 106 TAWEGGVFKLLLQFPPEYPFSPPSVRFTTKIFHPNV-YGNGDICLDTLKDKWCPSLSVES 164 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + LL+ PNP N +AA+MY+ ++Y Sbjct: 165 VLLMII-SLLSDPNPNSAANAEAASMYVQSRDKY 197 >UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria parva Length = 157 Score = 75.4 bits (177), Expect = 6e-13 Identities = 28/83 (33%), Positives = 52/83 (62%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+E G++++ +H P+ YP + P++ F K +HPNI+ +G +C+D++ W+ + + Sbjct: 45 TPFESGIFKLLIHCPNSYPIQPPTVHFATKCFHPNINFQTGELCIDILKSNWSPAWTIQY 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + +L+ PNP PLN DA Sbjct: 105 LCRGVI-YILSTPNPDSPLNCDA 126 >UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 601 Score = 75.4 bits (177), Expect = 6e-13 Identities = 31/92 (33%), Positives = 55/92 (59%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y GV+ + ++ P YPFK PS+ F+ +YH N++ G +C+D++ W+ ++ +F Sbjct: 453 YHQGVYMLYINFPQSYPFKPPSVKFITPIYHCNVNS-QGRICIDILKDNWSPALTMAAVF 511 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + +L+ +PNPID L + AA H+ + Y Sbjct: 512 NS-ISELMLHPNPIDALESNIAAEMNHEYDLY 542 >UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptosporidium parvum Iowa II|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 137 Score = 75.4 bits (177), Expect = 6e-13 Identities = 32/83 (38%), Positives = 50/83 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEG V+++ + + YP PS+ F+ ++HPN++ +G VC+DVI WT + L Sbjct: 28 TPYEGFVFKIEIIVSPQYPILPPSVKFVTPIFHPNVNFFTGEVCIDVIKDNWTPAWTLHA 87 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + + +L PNP PLN DA Sbjct: 88 VCRAII-SILCDPNPNSPLNCDA 109 >UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosphaeria nodorum|Rep: Ubiquitin carrier protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 465 Score = 75.4 bits (177), Expect = 6e-13 Identities = 31/86 (36%), Positives = 51/86 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY+ GVWR+ + +P YP P+ F +++HPNIDE +G VC++ + + W++ L + Sbjct: 87 TPYQNGVWRLHLDIPPTYPTAPPTAQFRTRLWHPNIDEATGAVCVETLKRDWSSALKLRD 146 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAM 441 + + + LL PNP LN A + Sbjct: 147 VLVT-ISCLLIQPNPASALNEAAGKL 171 >UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; 36006-34873; n=1; Arabidopsis thaliana|Rep: Putative ubiquitin conjugating enzyme; 36006-34873 - Arabidopsis thaliana (Mouse-ear cress) Length = 154 Score = 74.9 bits (176), Expect = 8e-13 Identities = 32/79 (40%), Positives = 47/79 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG++ + + P YPFK P F +YHPNI++ G++C++++ WT + Sbjct: 49 TPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNIND-EGSICMNILKDKWTPALMVEK 107 Query: 364 IFESFLPQLLTYPNPIDPL 420 + S L LL PNP DPL Sbjct: 108 VLLSIL-LLLEKPNPDDPL 125 >UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 74.5 bits (175), Expect = 1e-12 Identities = 31/94 (32%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY GG + + + +P +P ++P++ F K+YHPN++ G +CL ++ W+ + + Sbjct: 45 SPYAGGNFTINISVPPEFPLRAPAVTFGTKIYHPNVNP-EGNICLSLLKNEWSPKVKIMD 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I E + L++ P+PID LN + AA Y +EY Sbjct: 104 ILEQ-VYLLISAPDPIDALNTEIAAEYKDNHDEY 136 >UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 144 Score = 74.5 bits (175), Expect = 1e-12 Identities = 37/92 (40%), Positives = 51/92 (55%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G++ + +++P YP PSI F K+YHPNI+E +G +CLD + W Y L + Sbjct: 40 TPYEDGIFFLSMNIPAQYPASPPSIKFETKIYHPNINE-NGQICLDQLKNEWKPTYTLKH 98 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 E F+ LL PN PL A Y P+ Sbjct: 99 AIE-FIIFLLQNPNWDSPLMPQIGAEYAQDPK 129 >UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum|Rep: Peroxin 4 - Penicillium chrysogenum (Penicillium notatum) Length = 164 Score = 74.5 bits (175), Expect = 1e-12 Identities = 34/86 (39%), Positives = 50/86 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG+W + + +P YP+ P+I F K+ HPNI +G +C +N W +LS Sbjct: 54 SPYEGGLWGLDIRIPSDYPYAPPTIHFTTKIAHPNIAWSTGEIC-SSLNNDWKPTVNLSG 112 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAM 441 I + + LLT P+P PLN D A + Sbjct: 113 ILAA-IQLLLTVPDPDSPLNPDIAVL 137 >UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin-conjugating enzyme E2 16 - Schizosaccharomyces pombe (Fission yeast) Length = 160 Score = 74.5 bits (175), Expect = 1e-12 Identities = 32/86 (37%), Positives = 49/86 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG W + +H+ + YP PS+ F K+ HPNI +G VC+D++ W+ + L + Sbjct: 47 TPYEGGQWVLDIHVHEGYPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSLQS 106 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAM 441 + + L Y + PLN DAA + Sbjct: 107 ACLAIISLLSNY-DASSPLNVDAAKL 131 >UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 292 Score = 74.1 bits (174), Expect = 1e-12 Identities = 35/98 (35%), Positives = 56/98 (57%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ----AWTALY 351 TPY G++++ + LP YPF+ P I F+ +YHPNID +G +CLD++ W Sbjct: 52 TPYYKGLFKLEISLPSRYPFEPPQIKFLTPIYHPNID-TNGRICLDILKMPPSGEWKPSL 110 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 +L I S + L++ PNP DPL D + +Y + ++ Sbjct: 111 NLLTILTS-IRLLMSNPNPYDPLMQDISEIYKNNYNQF 147 >UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 182 Score = 74.1 bits (174), Expect = 1e-12 Identities = 31/83 (37%), Positives = 50/83 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+ GG +R+ + +P YP P F+ KV+HPN++ +G VCLD++ + W+ ++ LS+ Sbjct: 67 TPFAGGSYRLVLSIPHEYPLVPPKAAFITKVFHPNVEFNTGNVCLDILKKRWSPVWTLSS 126 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + L LL P P N DA Sbjct: 127 VCRAIL-NLLAEPESDSPFNCDA 148 >UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Homo sapiens (Human) Length = 179 Score = 74.1 bits (174), Expect = 1e-12 Identities = 33/87 (37%), Positives = 52/87 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YE +++ + P YP+ +P++ F+ YHPN+D G +CLD++ + W+ALYD+ Sbjct: 72 TVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD-TQGNICLDILKEKWSALYDVRT 130 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 I S + LL PN PLN AA ++ Sbjct: 131 ILLS-IQSLLGEPNIDSPLNTHAAELW 156 >UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=66; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 L3 - Homo sapiens (Human) Length = 154 Score = 74.1 bits (174), Expect = 1e-12 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 1/87 (1%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN-QAWTALYDLSN 363 PY+ G +R+ ++ P YPFK P I F K+YHPNIDE G VCL VI+ + W Sbjct: 45 PYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDE-KGQVCLPVISAENWKPATKTDQ 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 + +S + L+ P P PL D A Y Sbjct: 104 VIQSLI-ALVNDPQPEHPLRADLAEEY 129 >UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2N; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2N - Canis familiaris Length = 284 Score = 73.7 bits (173), Expect = 2e-12 Identities = 33/89 (37%), Positives = 53/89 (59%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q +P EGG + + + LP+ YP +P + FM K+YHPN+D++ G VCLD++ W+ L Sbjct: 131 QDSPLEGGTFELELFLPEEYPMAAPKVRFMTKIYHPNVDKL-GRVCLDILKDKWSPLQIR 189 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + + ++ LL+ NP DPL D + Sbjct: 190 TVLL--WIQALLSALNPDDPLAKDVVEQW 216 >UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 176 Score = 73.3 bits (172), Expect = 2e-12 Identities = 30/89 (33%), Positives = 54/89 (60%) Frame = +1 Query: 199 GVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESF 378 G +++ + + YP K P++ F+++++HPNI G++CLD++ W+ +YD++ I S Sbjct: 75 GTFKLTLQFTEDYPNKPPTVRFVSRMFHPNI-YADGSICLDILQNQWSPIYDVAAILTS- 132 Query: 379 LPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + LL PNP P N +AA ++ EY Sbjct: 133 IQSLLCDPNPNSPANSEAARLFSENKREY 161 >UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 354 Score = 73.3 bits (172), Expect = 2e-12 Identities = 34/87 (39%), Positives = 50/87 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YEGG +RV + P +YPF P + F+ K YH NI +SG +CLD++ W+ +S Sbjct: 250 TVYEGGRFRVEIVFPRNYPFYPPYLAFLTKTYHCNI-ALSGRICLDILGSKWSPALSVSK 308 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 + S + LL PNP DP+ A ++ Sbjct: 309 VLISIM-SLLADPNPHDPMEVSVADVF 334 >UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 149 Score = 73.3 bits (172), Expect = 2e-12 Identities = 32/94 (34%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +EG +R++ + YP P + F++ +HPNI + +G++C+D++ Q W+ YD + Sbjct: 45 TVWEGANFRMQFDFSEDYPHTCPEVKFVDIPFHPNIYQ-NGSICIDILQQNWSNAYDAAA 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LL PNP P N +A +Y+ EY Sbjct: 104 IMTSII-SLLVLPNPHSPANNEAGELYVKNTNEY 136 >UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilateria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 80 Score = 73.3 bits (172), Expect = 2e-12 Identities = 31/79 (39%), Positives = 48/79 (60%) Frame = +1 Query: 229 DHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNP 408 + YP K P++ F++K++HPN+ G++CLD++ W+ YD+S+I S + LL PNP Sbjct: 2 EEYPNKPPTVRFVSKMFHPNV-YADGSICLDILQNRWSPTYDVSSILTS-IQSLLDEPNP 59 Query: 409 IDPLNGDAAAMYLHKPEEY 465 P N AA +Y EY Sbjct: 60 NSPANSQAAQLYQENKREY 78 >UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 199 Score = 73.3 bits (172), Expect = 2e-12 Identities = 30/85 (35%), Positives = 51/85 (60%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y G W + + +P YP + P+I ++ + HPN+D G +CLD++ W+ ++L ++ Sbjct: 55 YYNGEWTLDITVPPTYPQQPPTIKYITPIIHPNVDLKLGEICLDILKSQWSPAWNLESLV 114 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMY 444 + L QL+ +P P PLN DAA +Y Sbjct: 115 VAIL-QLMDHPEPDSPLNIDAANLY 138 >UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kluyveromyces lactis|Rep: NEDD8-conjugating enzyme UBC12 - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 184 Score = 73.3 bits (172), Expect = 2e-12 Identities = 35/89 (39%), Positives = 50/89 (56%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y GG + V + D YP + P + M+++YHPNID + G VCL+++ + WT D+ +I Sbjct: 72 YAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNID-IDGNVCLNLLREDWTPALDIQSII 130 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKP 456 L L PN DPLN DAA + P Sbjct: 131 IGIL-FLFHEPNGRDPLNKDAAKTLIEDP 158 >UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 195 Score = 72.9 bits (171), Expect = 3e-12 Identities = 36/94 (38%), Positives = 55/94 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +EG +R+ + + YPFK P + F +HPN+D V G +CLD++ W++ YD+ Sbjct: 92 TVFEGTEYRLSLSFSNDYPFKPPKVKFETCCFHPNVD-VYGNICLDILQDKWSSAYDVRT 150 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + LL PN PLN AA ++ ++ EEY Sbjct: 151 ILLS-IQSLLGEPNISSPLNTQAAQLWSNQ-EEY 182 >UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 72.9 bits (171), Expect = 3e-12 Identities = 33/96 (34%), Positives = 52/96 (54%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q T + G++ + + D +P +P + F+ VYHPN+ G +CLD++ WT YD+ Sbjct: 47 QGTDWADGIFELEMVFKDDFPRSAPEVKFITPVYHPNVYR-DGKICLDMLQNKWTPAYDI 105 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S I S + L PNP P NG+AA + + +Y Sbjct: 106 SAILNS-IRSLFDDPNPASPANGEAAEAFQNNRPKY 140 >UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Theria|Rep: Uncharacterized protein UBE2C - Homo sapiens (Human) Length = 150 Score = 72.9 bits (171), Expect = 3e-12 Identities = 32/85 (37%), Positives = 51/85 (60%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YE +++ + P YP+ +P++ F+ YHPN+D G +CLD++ + W+ALYD+ I Sbjct: 45 YEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD-TQGNICLDILKEKWSALYDVRTIL 103 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMY 444 S + LL PN PLN AA ++ Sbjct: 104 LS-IQSLLGEPNIDSPLNTHAAELW 127 >UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 579 Score = 72.5 bits (170), Expect = 4e-12 Identities = 35/88 (39%), Positives = 47/88 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T Y GV+ V + P+ YPFK P F+ +YHPNI G +CLD++ W+ + Sbjct: 435 TTYNYGVFMVYITFPNDYPFKPPRTRFITPIYHPNISS-QGHMCLDILKDQWSPALTIQK 493 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL 447 SFL L+ PNP D L+ AA YL Sbjct: 494 SLNSFL-SLMQDPNPNDALDSTIAAQYL 520 >UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 209 Score = 72.5 bits (170), Expect = 4e-12 Identities = 31/98 (31%), Positives = 56/98 (57%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ----AWTALY 351 TPY G++++ + +P+ YPF+ P + F+ +YHPNID SG +CLD + W Sbjct: 45 TPYHKGIFKLDIQIPERYPFEPPKVRFVTPIYHPNIDS-SGRICLDTLKMPPKGMWKPAL 103 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++S++ + L L+ PNP DPL + + + + ++ Sbjct: 104 NISSVLSTIL-ILMAEPNPDDPLMAEISNEFKYNKAQF 140 >UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypanosoma cruzi|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 224 Score = 72.1 bits (169), Expect = 5e-12 Identities = 30/95 (31%), Positives = 57/95 (60%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNK-VYHPNIDEVSGTVCLDVINQAWTALYDLS 360 T +EGG++++++ D YP P + F+ + ++HPN+ V G +CLD + W+ + D+ Sbjct: 110 TVWEGGIFKLQLDFTDEYPCAPPKVRFLTRDMFHPNV-YVDGNICLDTLKTEWSPILDVE 168 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++ + LL+ PNP NG+AA +Y + ++Y Sbjct: 169 SLLMMII-SLLSDPNPSSAANGEAALLYTNAKDKY 202 >UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E2 21; n=5; Caenorhabditis|Rep: Probable ubiquitin-conjugating enzyme E2 21 - Caenorhabditis elegans Length = 229 Score = 72.1 bits (169), Expect = 5e-12 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 15/104 (14%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIG---------------FMNKVYHPNIDEVSGTVCL 318 TPY GG + ++V +P+HYPF+ P + F+ +++HPNI +GT+CL Sbjct: 63 TPYAGGTFEIKVDIPEHYPFEPPKVTEIIFHIRAFEYIQAKFVTRIWHPNISSQTGTICL 122 Query: 319 DVINQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 D++ WTA L + S L +L P P DP + A +++ Sbjct: 123 DILKDKWTASLTLRTVLLS-LQAMLCSPEPSDPQDAVVAKQFIN 165 >UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Eremothecium gossypii|Rep: NEDD8-conjugating enzyme UBC12 - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 184 Score = 72.1 bits (169), Expect = 5e-12 Identities = 36/92 (39%), Positives = 50/92 (54%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y GG +R V D YP + P++ +N +YHPNID SG +CL+V+ + W+ + DL + Sbjct: 72 YRGGHFRFSVVFRDTYPIEPPTVKCLNTIYHPNID-YSGNICLNVLREDWSPVMDLQTVV 130 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L L PN DPLN AA L P + Sbjct: 131 LGLL-FLFLEPNGSDPLNRQAADTMLRDPYRF 161 >UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 154 Score = 71.7 bits (168), Expect = 7e-12 Identities = 35/98 (35%), Positives = 53/98 (54%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI----NQAWTALY 351 +PY+G ++ + + +P+ YPF P + F+ VYHPNID G +C+D++ N W Sbjct: 43 SPYKGALFELELEIPERYPFVPPHLKFITPVYHPNID-TQGRICMDLLKMPPNGGWKPTI 101 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L N+ + + LL PNP DPL D A Y E+ Sbjct: 102 SLENLIVA-VQSLLGNPNPDDPLMVDIAEEYRFNKTEF 138 >UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 901 Score = 71.7 bits (168), Expect = 7e-12 Identities = 28/83 (33%), Positives = 52/83 (62%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY G++ + ++LP +YP ++P + F +++HPNI +G +CL+V+ W+ + L Sbjct: 779 SPYSDGIFELGINLPSNYPIQAPQVIFKTRIFHPNIHWETGEICLNVVKDEWSPYWTLEA 838 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + + QL++ PN PLN DA Sbjct: 839 LCRA-VQQLMSNPNADSPLNCDA 860 >UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabidopsis thaliana|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 409 Score = 71.3 bits (167), Expect = 9e-12 Identities = 33/98 (33%), Positives = 56/98 (57%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----QAWTALY 351 T Y G++ +++ +P+ YPF+ P + F +YHPNID SG +CLD++N AW Sbjct: 57 TVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDN-SGRICLDILNLPPKGAWQPSL 115 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++S + S + LL+ PNP D L + + Y + + + Sbjct: 116 NISTVLTS-MRLLLSEPNPDDGLMCEVSREYKYNRQTF 152 >UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=5; Plasmodium|Rep: Ubiquitin-conjugating enzyme E2, putative - Plasmodium falciparum (isolate 3D7) Length = 155 Score = 71.3 bits (167), Expect = 9e-12 Identities = 29/83 (34%), Positives = 48/83 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG W++ + YP P I F+ K +HPN++ V+G +C+D++ W+ + + + Sbjct: 43 SPYEGGKWKLNIKCKSTYPIDPPLITFVTKFFHPNVNFVTGELCMDILKANWSPAWTIQS 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + + L L PN PLN DA Sbjct: 103 LCRAIL-FLFNEPNADSPLNCDA 124 >UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveolata|Rep: Ubiquitin carrier protein - Plasmodium berghei Length = 149 Score = 71.3 bits (167), Expect = 9e-12 Identities = 28/88 (31%), Positives = 54/88 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +E G++ + ++ + YP P + F++K++HPNI G +CLD++ W+ +YD+++ Sbjct: 35 TIWECGIFHLIINFSEEYPVSPPKVKFLSKMFHPNI-YTDGNICLDILQNQWSPIYDITS 93 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL 447 + S + LL PN P N +AA +++ Sbjct: 94 LLTS-IQSLLNDPNTASPANPEAAKIFM 120 >UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Xenopus laevis (African clawed frog) Length = 179 Score = 71.3 bits (167), Expect = 9e-12 Identities = 33/87 (37%), Positives = 51/87 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YE +++ + P YP+ +P++ F+ +HPN+D G +CLD++ W+ALYD+ Sbjct: 72 TVYEDLRYKLSLEFPSGYPYNAPTVKFVTPCFHPNVDS-HGNICLDILKDKWSALYDVRT 130 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 I S L LL PN PLN AA ++ Sbjct: 131 ILLS-LQSLLGEPNNESPLNPYAAELW 156 >UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=112; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 E2 - Homo sapiens (Human) Length = 201 Score = 71.3 bits (167), Expect = 9e-12 Identities = 34/92 (36%), Positives = 50/92 (54%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEGGV+ + + YPFK P + F ++YH NI+ G +CLD++ W+ +S + Sbjct: 99 YEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINS-QGVICLDILKDNWSPALTISKVL 157 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + LLT NP DPL G A Y+ E+ Sbjct: 158 LS-ICSLLTDCNPADPLVGSIATQYMTNRAEH 188 >UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 173 Score = 70.9 bits (166), Expect = 1e-11 Identities = 37/101 (36%), Positives = 53/101 (52%), Gaps = 4/101 (3%) Frame = +1 Query: 175 LQVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ----AWT 342 L+ TPYEGG + + + +P YP P+I F +YHPNID SG +CLD + WT Sbjct: 44 LKDTPYEGGEFHLSITIPPKYPNVPPTIKFKTPIYHPNIDS-SGRICLDFLKPQPQGKWT 102 Query: 343 ALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 A L + + QL+ PNP DPL+ A + ++ Sbjct: 103 ATVSLEMLLTQ-IQQLMAEPNPNDPLDTKIAQEFTENKAKF 142 >UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 232 Score = 70.9 bits (166), Expect = 1e-11 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTAL-YDLS 360 TP++GGV+R ++ LP +P +P F K++HPN+ E G +C++ + + W L + L Sbjct: 85 TPFQGGVFRCKLILPPQFPQVAPKGLFNTKIFHPNVSE-KGEICVNTLKKDWNPLQWSLK 143 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 NIFE + LL P P LN +A +++ +EY Sbjct: 144 NIFE-VIKCLLIVPFPESSLNEEAGKLFMENYDEY 177 >UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Saccharomycetaceae|Rep: Ubiquitin carrier protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 211 Score = 70.9 bits (166), Expect = 1e-11 Identities = 33/102 (32%), Positives = 60/102 (58%), Gaps = 4/102 (3%) Frame = +1 Query: 172 DLQVTP----YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW 339 +L +TP Y+ G + ++ + ++P P I +NK+YHPNID + G +CL+++ + W Sbjct: 90 ELTITPQSGYYKSGHFHFKIEISGNFPIDPPKIKCVNKIYHPNID-LQGNICLNILREDW 148 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + L+++ L L PNP DPLN +AA M + +++ Sbjct: 149 SPVLSLNSVLIG-LNFLFLEPNPNDPLNKEAANMLVKDKKQF 189 >UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 368 Score = 70.5 bits (165), Expect = 2e-11 Identities = 26/59 (44%), Positives = 40/59 (67%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 +PY GGV+ V +H P YPFK P + F KV+HPNI+ +G++CLD++ + W+ +S Sbjct: 144 SPYAGGVFLVNIHFPPDYPFKPPKVSFKTKVFHPNINS-NGSICLDILKEQWSPALTIS 201 >UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidiomycota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 458 Score = 70.5 bits (165), Expect = 2e-11 Identities = 37/88 (42%), Positives = 50/88 (56%), Gaps = 1/88 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLS 360 +PY GG + V + P YPFKSP + F ++YHPNIDE SG +C+ ++ ++AW Sbjct: 44 SPYAGGTFLVDMDFPIEYPFKSPKVKFNTRIYHPNIDE-SGNLCVGILKSEAWKPSTKAV 102 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMY 444 I S L QLL PN D L A +Y Sbjct: 103 TILLSIL-QLLDEPNADDALVASIAELY 129 >UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like protein; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme-like protein - Leishmania major Length = 260 Score = 69.7 bits (163), Expect = 3e-11 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNK-VYHPNIDEVSGTVCLDVINQAWTALYDLS 360 TP+EGG++++ + D YPF P + F K V+HPN+ V G +C+D + +W + +L Sbjct: 136 TPWEGGLFKLDLIFGDDYPFSPPKVRFRTKDVFHPNV-YVDGNICMDTLKSSWQSSLNLE 194 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL+ PNP+ NG AA + Y Sbjct: 195 ALLIS-IQSLLSDPNPLSAANGAAARLLTENRSAY 228 >UniRef50_Q4P877 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 168 Score = 69.7 bits (163), Expect = 3e-11 Identities = 24/53 (45%), Positives = 40/53 (75%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWT 342 +P+EGGV+R+ + LP+ YP +P + F+ K+YHPNID++ G +CLD++ W+ Sbjct: 44 SPFEGGVFRLELFLPEEYPMSAPKVRFLTKIYHPNIDKL-GRICLDILKDKWS 95 >UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; Sordariomycetes|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 166 Score = 69.7 bits (163), Expect = 3e-11 Identities = 30/84 (35%), Positives = 46/84 (54%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+ G W + + +P YP P++ F+ V H N++ G VCLD++ +AWT Y + Sbjct: 57 YDAGRWLLEIKIPPTYPLHPPTVRFVTPVVHANVNLADGEVCLDLLKEAWTPAYSVLETV 116 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAM 441 + + LL P P PLN D AA+ Sbjct: 117 RA-VRLLLATPEPDSPLNVDVAAL 139 >UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 S - Homo sapiens (Human) Length = 222 Score = 69.7 bits (163), Expect = 3e-11 Identities = 32/94 (34%), Positives = 56/94 (59%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY GG++R+++ L +P P F+ K++HPN+ +G +C++V+ + WTA + + Sbjct: 53 TPYAGGLFRMKLLLGKDFPASPPKGYFLTKIFHPNVG-ANGEICVNVLKRDWTAELGIRH 111 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + + LL +PNP LN +A + L EEY Sbjct: 112 VLLT-IKCLLIHPNPESALNEEAGRLLLENYEEY 144 >UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2. - Takifugu rubripes Length = 156 Score = 68.9 bits (161), Expect = 5e-11 Identities = 24/59 (40%), Positives = 40/59 (67%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 +PY+GGV+ + +H P YPFK P + F ++YHPNI+ +G++CLD++ W+ +S Sbjct: 14 SPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS-NGSICLDILRSQWSPALTIS 71 >UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 144 Score = 68.9 bits (161), Expect = 5e-11 Identities = 29/83 (34%), Positives = 48/83 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY+G + + +P YP P I F+++++HPN+ +G +CLD++ WT + + Sbjct: 44 TPYQGKSFNIECSVPLSYPLSPPKITFVDQIFHPNVYPSNGEICLDILKNQWTPAWTILF 103 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 ++ + LLT P P PLN DA Sbjct: 104 SCQAII-VLLTNPEPNSPLNCDA 125 >UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoliophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 556 Score = 68.5 bits (160), Expect = 7e-11 Identities = 32/98 (32%), Positives = 57/98 (58%), Gaps = 4/98 (4%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----QAWTALY 351 T Y GV+ +++ +P+ YPF+ P++ F+ +YHPNID G +CLD++N AW Sbjct: 53 TVYSKGVFVLKIQIPERYPFQPPNVTFVTPIYHPNIDN-GGRICLDILNLPPKGAWQPSL 111 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 +++ + S + LL+ PNP D L + + Y + + + Sbjct: 112 NIATVLTS-IGLLLSDPNPDDGLMAEISREYKYNRQVF 148 >UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_117, whole genome shotgun sequence - Paramecium tetraurelia Length = 1189 Score = 68.5 bits (160), Expect = 7e-11 Identities = 32/94 (34%), Positives = 55/94 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGGV+ + + + YP K P++ F+ +YH NI+ G +C ++++ +T + Sbjct: 1034 TPYEGGVYILYLQFDESYPIKPPNLRFLTPIYHCNINS-QGRICHSILDRNYTLDTTVLQ 1092 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IF++ L+T P P DPL+ A+ YL ++Y Sbjct: 1093 IFQAIFGLLMT-PEPDDPLDTTIASEYLENLQQY 1125 >UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 153 Score = 68.5 bits (160), Expect = 7e-11 Identities = 34/86 (39%), Positives = 50/86 (58%), Gaps = 2/86 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNID-EVSGTVCLDVINQ-AWTALYDL 357 TPY GG++ + V LP YPFK P + F+ ++YHPNI + G++C+D + Q W + Sbjct: 44 TPYAGGLFVLNVVLPKDYPFKPPVVNFVTRIYHPNITFDEKGSICVDELKQDKWKPSGKI 103 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAA 435 + I + + LL PNP DPL A Sbjct: 104 TAILGA-IRNLLITPNPDDPLENTIA 128 >UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; Eukaryota|Rep: NEDD8-conjugating enzyme UBC12 - Yarrowia lipolytica (Candida lipolytica) Length = 179 Score = 68.5 bits (160), Expect = 7e-11 Identities = 33/92 (35%), Positives = 51/92 (55%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GG +R ++ ++P + P + + KVYHPNID + G VCL+++ + W + L+ + Sbjct: 66 YQGGEFRFSFYVNPNFPHEPPKVKCLQKVYHPNID-LEGNVCLNILREDWKPVLSLNAVM 124 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L L PN DPLN DAA EE+ Sbjct: 125 IG-LQYLFLEPNASDPLNKDAAHQMTANREEF 155 >UniRef50_Q0R0E7 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 167 Score = 68.1 bits (159), Expect = 9e-11 Identities = 34/100 (34%), Positives = 56/100 (56%), Gaps = 4/100 (4%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYD 354 Q T +EGGVW++++ + YP K PS+ F N+V+HPNI G +CLD++ W+ YD Sbjct: 45 QDTAWEGGVWKLKMSFNEEYPEKPPSVRFENEVFHPNIFP-DGQICLDLLKGSGWSPAYD 103 Query: 355 LSNI---FESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + I +S L T+ P N +A ++++ + Y Sbjct: 104 VCTILLAIQSLLADPDTHATPEGGANPEAESLFVRDRQGY 143 >UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 203 Score = 68.1 bits (159), Expect = 9e-11 Identities = 32/94 (34%), Positives = 53/94 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY+GG +R+++ +P YP + P F K++HPNI +G VC++ + + W + L + Sbjct: 49 TPYDGGKFRLKMLIPVQYPIEPPKAYFCTKIFHPNIAPNTGEVCVNTLKKDWKSNLGLRH 108 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + + LL PNP LN +A + L E+ Sbjct: 109 ILLT-IRCLLIEPNPESALNEEAGKLLLEDYNEF 141 >UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 230 Score = 68.1 bits (159), Expect = 9e-11 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 4/102 (3%) Frame = +1 Query: 172 DLQVTP----YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW 339 +L +TP Y+ ++ +++P YP+ P + VYHPNID + G VCL+++ Q W Sbjct: 109 NLSITPTDGLYQSATFQFTINIPSTYPYDPPKVHCDTLVYHPNID-LEGHVCLNILRQDW 167 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + ++ + L L PNP DPLN DAA + + + + Sbjct: 168 MPVLNIGTVIFG-LMTLFLEPNPDDPLNKDAAQLMIDNKKTF 208 >UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dictyostelium discoideum|Rep: Ubiquitin conjugating enzyme - Dictyostelium discoideum AX4 Length = 148 Score = 68.1 bits (159), Expect = 9e-11 Identities = 29/87 (33%), Positives = 51/87 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +P+E GV+ + + +P YPFK P++ F K+YHPNI G +C +V + W+ + + Sbjct: 44 SPFEKGVFSMDIDIPADYPFKPPTLKFTTKIYHPNIKTSDGAICAEVFS-TWSPQLKILD 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 + + + +LT PNP +PL + A + Sbjct: 103 VLTT-IRSILTDPNPDNPLETEIAQQF 128 >UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichomonas vaginalis|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 164 Score = 68.1 bits (159), Expect = 9e-11 Identities = 32/92 (34%), Positives = 51/92 (55%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 + G + +PD +P P I + +V+HPNIDE +G VCL ++ + A +S F Sbjct: 61 WRAGKFEFEFTIPDDWPITKPDIKILTRVWHPNIDE-NGAVCLSILRDNYLATLSISQ-F 118 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + L L PNP PLN +AA M+ ++P ++ Sbjct: 119 VAGLQYLFIEPNPNSPLNTEAATMFKNEPAKF 150 >UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_14, whole genome shotgun sequence - Paramecium tetraurelia Length = 150 Score = 68.1 bits (159), Expect = 9e-11 Identities = 34/96 (35%), Positives = 51/96 (53%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 Q + YE G + + V P+ YP KSP I F+ +YH NID +G +CL+++ Q W+ + Sbjct: 43 QGSSYENGNFTLDVLFPEDYPLKSPKILFLTSIYHLNIDYNTGQICLEILGQNWSPNLTI 102 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S L LL PNP PL D ++ + Y Sbjct: 103 RKLLLSIL-ALLYDPNPNSPLLEDVNTIFKNDKAAY 137 >UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 67.7 bits (158), Expect = 1e-10 Identities = 30/94 (31%), Positives = 54/94 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+EGG + +++ + + +P K P F+ K++HPNI + +G +C+ ++ WT L + Sbjct: 49 TPFEGGEFDIKLEIGEEFPQKPPKGYFLTKIFHPNISD-AGAICVSTLSSDWTEDMGLDH 107 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL PNP LN +A ++ E+Y Sbjct: 108 LLLS-IKCLLLQPNPSSALNEEAGRLFSENYEDY 140 >UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 197 Score = 67.7 bits (158), Expect = 1e-10 Identities = 29/87 (33%), Positives = 46/87 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG +++ + L + YP+K P + F +++HPNI +G +CLD++ W+ + Sbjct: 50 TPYEGGYFQIDIVLTNDYPYKPPKMKFDTRIWHPNISSQTGAICLDILKDQWSPALSIRT 109 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 S L L P P P + A Y Sbjct: 110 ALLS-LQALFCDPQPDSPQDAVVANQY 135 >UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomycota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 194 Score = 67.7 bits (158), Expect = 1e-10 Identities = 29/92 (31%), Positives = 53/92 (57%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+ G + ++ + ++P P I + K+YHPNID + G +CL+++ + W+ + L+ +F Sbjct: 83 YKNGKFEFKIEINSNFPIDPPKIKCLQKIYHPNID-LQGNICLNILREDWSPVLSLTGVF 141 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L L PN DPLN DAA + + +++ Sbjct: 142 MG-LNFLFLDPNATDPLNKDAANVLVKNRKQF 172 >UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophophora|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 239 Score = 67.3 bits (157), Expect = 2e-10 Identities = 29/77 (37%), Positives = 49/77 (63%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEGG +R+ + P YPF++P I F ++YH N+D G +CLDV+ + W+ + +++ + Sbjct: 106 YEGGHFRLDIRFPASYPFRAPRIRFTTRIYHCNVDS-RGAICLDVLGERWSPVMNVAKVL 164 Query: 370 ESFLPQLLTYPNPIDPL 420 S + L++ NP DPL Sbjct: 165 LS-IYVLMSECNPDDPL 180 >UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 204 Score = 67.3 bits (157), Expect = 2e-10 Identities = 34/92 (36%), Positives = 45/92 (48%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEG + + V PD YPF P + F VYHPN+ + VCLD+I W ++ N+ Sbjct: 95 YEGSYYTLYVDFPDDYPFSPPQVMFKYPVYHPNV-YPTNQVCLDIIGDRWKPSLNIMNVL 153 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + QLL PN P N DA+ P Y Sbjct: 154 -CGIQQLLGSPNTRSPANTDASGCLRRDPAGY 184 >UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 219 Score = 67.3 bits (157), Expect = 2e-10 Identities = 37/96 (38%), Positives = 49/96 (51%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTALYDL 357 T +EG V+ V + PD YP K P + F K YHPN+ SGTVCL ++N Q W L Sbjct: 111 TIWEGAVYPVTLEFPDEYPSKPPKVKFRPKFYHPNV-YPSGTVCLSILNESQDWKPAITL 169 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + I + +LL PN P DA ++H Y Sbjct: 170 TQILLG-VQELLDTPNKESPAQEDAYRHFVHDMNTY 204 >UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=4; Homo/Pan/Gorilla group|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Homo sapiens (Human) Length = 152 Score = 67.3 bits (157), Expect = 2e-10 Identities = 34/92 (36%), Positives = 49/92 (53%), Gaps = 1/92 (1%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLSN 363 PY + +R+ P YPFK P I F K+YHPN+DE +G +CL +I ++ W Sbjct: 44 PYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDE-NGQICLPIISSENWKPCTKTCQ 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 + E+ L L+ PN +PL D A + PE Sbjct: 103 VLEA-LNVLVNRPNIREPLRMDLADLLTQNPE 133 >UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 486 Score = 66.9 bits (156), Expect = 2e-10 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWT-ALYDLS 360 TPYEGG++R ++ LP +P P F+ K++HPN+ E G +C++ + + W + Sbjct: 57 TPYEGGLFRCKLVLPQDFPKSPPKGYFITKIFHPNVSE-KGEICVNTLKKDWNHQSWSFY 115 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 NIFE + LL P P LN +A +++ + Y Sbjct: 116 NIFE-VIKCLLIIPFPESALNEEAGKLFMEDYDSY 149 >UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 268 Score = 66.9 bits (156), Expect = 2e-10 Identities = 32/91 (35%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +P+ GG++ V + LP+ YPFK P I F +YH N++ +G +CLD++ +W+ + Sbjct: 168 SPFVGGIFAVDIVLPNDYPFKPPKINFHTPIYHCNVN-TNGAICLDILKDSWSPSLSVFK 226 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL-HK 453 ES + L+ PNP D + A + L HK Sbjct: 227 CLES-IRALMADPNPDDAMRQWIAELTLAHK 256 >UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 66.9 bits (156), Expect = 2e-10 Identities = 30/88 (34%), Positives = 49/88 (55%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+EGG +++ + L D YP + P + K+YHPNID++ G +CLD++ WT + ++ Sbjct: 44 TPFEGGKFKLELFLTDKYPIEPPKAHMLTKIYHPNIDKL-GRICLDILKTEWTPVMNIET 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYL 447 S + L+ P DPL Y+ Sbjct: 103 TVLS-IQSLMCEPCLEDPLETQICQHYV 129 >UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizomycotina|Rep: Ubiquitin carrier protein - Neurospora crassa Length = 212 Score = 66.9 bits (156), Expect = 2e-10 Identities = 29/74 (39%), Positives = 43/74 (58%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY G +++ P +YP+ P++ F +YHPN+D SG +CLD++ WTA Y+ Sbjct: 140 TPYAGLTFKLSFEFPANYPYAPPTVLFRTPIYHPNVD-FSGRICLDILKDKWTAAYNTQT 198 Query: 364 IFESFLPQLLTYPN 405 + S L LL PN Sbjct: 199 VLLS-LQSLLGEPN 211 >UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerotiniaceae|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 185 Score = 66.9 bits (156), Expect = 2e-10 Identities = 30/82 (36%), Positives = 49/82 (59%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GG+++ + +P+ +P + P + K+YHPNID V G +CL+++ + W + +L I Sbjct: 72 YKGGIFKFKFAVPETFPHEPPKVNCEQKIYHPNID-VEGKICLNILREDWKPVLNLQAIV 130 Query: 370 ESFLPQLLTYPNPIDPLNGDAA 435 L L PN DPLN +AA Sbjct: 131 IG-LQFLFLEPNASDPLNKEAA 151 >UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 789 Score = 66.5 bits (155), Expect = 3e-10 Identities = 29/70 (41%), Positives = 43/70 (61%) Frame = +1 Query: 235 YPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPID 414 YP+ +P++ F+ YHPN+D G +CLD++ W+ALYD+ I S + LL PN Sbjct: 695 YPYNAPTVRFVTPCYHPNVD-AQGNICLDILKDKWSALYDVRTILLS-IQSLLGEPNVDS 752 Query: 415 PLNGDAAAMY 444 PLN AA ++ Sbjct: 753 PLNTHAAELW 762 >UniRef50_Q8LC61 Cluster: E2, ubiquitin-conjugating enzyme, putative; n=2; Arabidopsis thaliana|Rep: E2, ubiquitin-conjugating enzyme, putative - Arabidopsis thaliana (Mouse-ear cress) Length = 177 Score = 66.5 bits (155), Expect = 3e-10 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 2/95 (2%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNI 366 PYE GV+ V VH+P YP++ P I F K++HPNI E+ G +D++ W++ ++ + Sbjct: 73 PYEKGVFTVSVHIPPKYPYEPPKITFKTKIFHPNISEI-GESFVDILGSRWSSALTINLV 131 Query: 367 FESFLPQLLTYPNPIDPL--NGDAAAMYLHKPEEY 465 S L NP++PL + AA +Y + Y Sbjct: 132 LLSICSIL---SNPVEPLLVSNHAARLYQKDRKAY 163 >UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 416 Score = 66.5 bits (155), Expect = 3e-10 Identities = 36/94 (38%), Positives = 48/94 (51%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY GGV+ V V P YPF+ P + F KVYHPNID G + LD+ W+ ++ Sbjct: 247 TPYAGGVFPVDVWFPYDYPFRPPKLFFKTKVYHPNIDG-KGRMALDIFQDNWSPALTINK 305 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + F+ +L P P N A Y H+ E Y Sbjct: 306 LLLCFV-SVLFDPLLDRPTNRCIAKQYKHEYEAY 338 Score = 36.7 bits (81), Expect = 0.25 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKV 276 TPY GG + V V P+ YPF+ P + F KV Sbjct: 78 TPYAGGTFPVDVWYPNEYPFQPPKLTFKTKV 108 >UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 215 Score = 66.5 bits (155), Expect = 3e-10 Identities = 31/94 (32%), Positives = 52/94 (55%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG ++ R+ L +P P F+ K++HPN+ + G +C++ + + WT L + Sbjct: 51 TPYEGGYFKARLILSSDFPRSPPKANFITKIFHPNVSK-KGEICVNTLKKDWTEDLGLKH 109 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + + LL PN LN DA+ + L ++Y Sbjct: 110 ILLT-IKCLLIVPNAESSLNEDASRLLLENYDDY 142 >UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 66.5 bits (155), Expect = 3e-10 Identities = 27/80 (33%), Positives = 48/80 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T + G +++ + L D YP + P F+ K++HPNI GT+CLD++ WT + +++ Sbjct: 44 TAFAGHYFKLDIVLKDGYPIEPPQAKFITKIFHPNISFKDGTICLDILKTEWTPAWTINS 103 Query: 364 IFESFLPQLLTYPNPIDPLN 423 + + + LL++P P PLN Sbjct: 104 LCTA-IRLLLSHPEPDSPLN 122 >UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 246 Score = 66.5 bits (155), Expect = 3e-10 Identities = 31/94 (32%), Positives = 50/94 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG +R+R +P P + K++HPNI + SG +C+D + + W Y + + Sbjct: 48 TPYEGGYFRIRFAFGSEFPNLPPKCTMVTKIFHPNISK-SGEICVDTLKKGWKKEYGVGH 106 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + + LL +PNP L+ +A L E Y Sbjct: 107 VLIT-IKCLLIFPNPESALDEEAGKQLLEDYEGY 139 >UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Saccharomycetales|Rep: NEDD8-conjugating enzyme UBC12 - Saccharomyces cerevisiae (Baker's yeast) Length = 188 Score = 66.1 bits (154), Expect = 4e-10 Identities = 32/92 (34%), Positives = 49/92 (53%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y G + + YP + P + + K++HPNID + G VCL+++ + W+ DL +I Sbjct: 75 YNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNID-LKGNVCLNILREDWSPALDLQSII 133 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L L PNP DPLN DAA + +E+ Sbjct: 134 TGLL-FLFLEPNPNDPLNKDAAKLLCEGEKEF 164 >UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23; n=1; Caenorhabditis elegans|Rep: Ubiquitin conjugating enzyme protein 23 - Caenorhabditis elegans Length = 546 Score = 65.3 bits (152), Expect = 6e-10 Identities = 28/84 (33%), Positives = 51/84 (60%), Gaps = 4/84 (4%) Frame = +1 Query: 175 LQVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCL-DVINQAW---T 342 ++ TPYEGG++ + + + + YPFK+P++ F+ K++HP++ GT+CL DV N W Sbjct: 388 VEETPYEGGIFELDIKIGESYPFKAPTVKFITKIWHPSVSPFDGTICLHDVDNGVWPVSM 447 Query: 343 ALYDLSNIFESFLPQLLTYPNPID 414 +Y + + +S++ PID Sbjct: 448 TIYKVLIVIQSWMSN-FNEKEPID 470 >UniRef50_A6RY09 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 167 Score = 65.3 bits (152), Expect = 6e-10 Identities = 38/140 (27%), Positives = 57/140 (40%), Gaps = 3/140 (2%) Frame = +1 Query: 31 LRNSITKHVVTERWETTHGTPMSSNXXXXXXXXXXXXXXXXXXXXXXDLQVTP---YEGG 201 + S TK ++TE H P +S P Y GG Sbjct: 1 MSRSPTKRILTELSAYNHSPPSASQTGIVALAPSPASILSLSAILQCPASSPPSLGYLGG 60 Query: 202 VWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFL 381 W + + LP +YP +P I F+ K+ HPN+ +G +CLDV+ WT + + ES Sbjct: 61 RWLLSIALPTNYPIGAPIIRFVTKICHPNVKWETGEICLDVLGDKWTPVLGVVGALESIA 120 Query: 382 PQLLTYPNPIDPLNGDAAAM 441 + + PLN D A + Sbjct: 121 SLVAGGGDETSPLNVDIAKL 140 >UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 549 Score = 64.9 bits (151), Expect = 8e-10 Identities = 31/94 (32%), Positives = 50/94 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEG + V + +P+ YP + P + F ++ HPNI E SG +CL+++ W+ + + Sbjct: 400 TPYEGIPYTVTIVIPEDYPTEPPKVTFNQQILHPNISE-SGEICLNILQDKWSTVLTIQK 458 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL N D N A +Y PE + Sbjct: 459 VLVSIV-SLLYEKNLDDVYNHYAKTLYKEDPEGF 491 >UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 157 Score = 64.9 bits (151), Expect = 8e-10 Identities = 34/95 (35%), Positives = 51/95 (53%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSP-SIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 TP+E GV+ V + LP YP P SI F + HPN+D +G VC +++ W Y++ Sbjct: 44 TPWEDGVFSVDIQLPQDYPNSHPVSIRFTTPIIHPNVD-ANGNVCHNILFNEWDPSYNIY 102 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I S + L+ PN +P N + A +Y + EY Sbjct: 103 TILIS-IYLLIIEPNTNEPANPEIAQLYTNNNAEY 136 >UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 64.9 bits (151), Expect = 8e-10 Identities = 32/97 (32%), Positives = 54/97 (55%), Gaps = 5/97 (5%) Frame = +1 Query: 175 LQVTPYEGGVWRV-----RVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW 339 ++V P E G+W + +PD +PF+ P + + K++HPNIDE G+VCL ++ +A+ Sbjct: 47 VRVQP-ESGLWELGQFDFEFRIPDEFPFQRPRVKCLTKIFHPNIDE-EGSVCLSILREAY 104 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 + + + L T P P DPLN +AA ++ Sbjct: 105 NPTVSIPFLIAG-IQYLFTEPEPNDPLNKEAAQQMIN 140 >UniRef50_Q2KGQ4 Cluster: Ubiquitin carrier protein; n=1; Magnaporthe grisea 70-15|Rep: Ubiquitin carrier protein - Magnaporthe grisea 70-15 Length = 292 Score = 64.9 bits (151), Expect = 8e-10 Identities = 25/48 (52%), Positives = 37/48 (77%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI 327 +PYEGGV+++ + LPD YP P I F+ K+YHPN+D++ G +CLDV+ Sbjct: 44 SPYEGGVFKLDLFLPDDYPMTPPKIRFVTKIYHPNVDKL-GRICLDVL 90 >UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin conjugating enzyme Ubc14 - Schizosaccharomyces pombe (Fission yeast) Length = 155 Score = 64.5 bits (150), Expect = 1e-09 Identities = 34/86 (39%), Positives = 45/86 (52%), Gaps = 1/86 (1%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLSNI 366 Y GG + + P YPF+ P+I F ++YHPN D G VCL ++ Q + L ++ Sbjct: 51 YAGGKFHFSLKFPLDYPFQPPTIEFTTRIYHPNFDS-EGNVCLAILKQQVFKPSIKLRSV 109 Query: 367 FESFLPQLLTYPNPIDPLNGDAAAMY 444 E L QLL PNP DPL A Y Sbjct: 110 LEQIL-QLLREPNPDDPLVASIAEQY 134 >UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 192 Score = 64.5 bits (150), Expect = 1e-09 Identities = 32/91 (35%), Positives = 54/91 (59%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+ G ++ + ++YP + P + MNK++HPNID + G +CL+++ + W+ DL++I Sbjct: 81 YKSGKFKFDLKFNENYPIEPPIVLCMNKIFHPNID-LDGKICLNILREDWSPALDLNSII 139 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEE 462 L L N DPLN +AA + LH E+ Sbjct: 140 IGLL-YLFLECNAKDPLNKEAANI-LHSDED 168 >UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 191 Score = 64.1 bits (149), Expect = 1e-09 Identities = 33/98 (33%), Positives = 48/98 (48%), Gaps = 2/98 (2%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ--AWTALY 351 Q T +EGG + + +H + YP K P F +HPN+ SGTVCL ++N+ W Sbjct: 81 QGTDWEGGYYPLTLHFSEDYPSKPPKCKFPQGFFHPNV-YPSGTVCLSILNEDSGWRPAI 139 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + I + LL PNP DP D +++ EY Sbjct: 140 TVKQILVG-IQDLLDQPNPADPAQTDGYHIFIQDKPEY 176 >UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD subunit; n=1; Guillardia theta|Rep: Ubiquitin-conjugating enzyme E2-17 KD subunit - Guillardia theta (Cryptomonas phi) Length = 147 Score = 63.7 bits (148), Expect = 2e-09 Identities = 31/95 (32%), Positives = 56/95 (58%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNK-VYHPNIDEVSGTVCLDVINQAWTALYDLS 360 +PY G + +V+++ ++YP+ P+I N+ + HPNI +G VC+D++N+ W+ +Y Sbjct: 46 SPYSGILVKVQINFSENYPYDPPTIYIRNRHIIHPNIYS-NGKVCIDILNKKWSPVYSNI 104 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S L LL +PN P N A +++ K + Y Sbjct: 105 TLLLS-LKILLEFPNSDSPANLRATNLFIRKKKLY 138 >UniRef50_UPI0000E4A01C Cluster: PREDICTED: similar to ENSANGP00000017916; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ENSANGP00000017916 - Strongylocentrotus purpuratus Length = 206 Score = 63.3 bits (147), Expect = 3e-09 Identities = 23/64 (35%), Positives = 41/64 (64%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+E G +++ + + YP K P++ F++K++HPN+ G +CLD++ W+ YD+S Sbjct: 129 TPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNV-YADGGICLDILQNRWSPTYDVSA 187 Query: 364 IFES 375 I S Sbjct: 188 ILTS 191 >UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Rep: AFR314Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 155 Score = 63.3 bits (147), Expect = 3e-09 Identities = 31/89 (34%), Positives = 54/89 (60%), Gaps = 2/89 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGF-MNKVYHPNIDEVSGTVCLDVI-NQAWTALYDL 357 TPY G + +R+++P+ YP + P F + + HPNI +G VCLD++ ++AW+ +Y+L Sbjct: 47 TPYAGFTFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNL 106 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + E+ + LL P PL+ D + +Y Sbjct: 107 LQVVEA-ISTLLAEPGVDSPLDVDLSRLY 134 >UniRef50_UPI0000213DB4 Cluster: ubiquitin-conjugating enzyme E2L 3 isoform 2; n=2; Mammalia|Rep: ubiquitin-conjugating enzyme E2L 3 isoform 2 - Homo sapiens Length = 121 Score = 62.9 bits (146), Expect = 3e-09 Identities = 26/48 (54%), Positives = 33/48 (68%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN 330 PY+ G +R+ ++ P YPFK P I F K+YHPNIDE G VCL VI+ Sbjct: 45 PYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDE-KGQVCLPVIS 91 >UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypanosomatidae|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 238 Score = 62.9 bits (146), Expect = 3e-09 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA--WTALYDL 357 TP+EGG +R+ +H + YP + P F ++HPN+ SGTVCL ++N+ W + Sbjct: 128 TPFEGGEFRLLLHFTEDYPTRPPKCVFTPVLFHPNV-YPSGTVCLSILNEEKDWRPSITI 186 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + + +LL PN DP + +Y+ +EY Sbjct: 187 KQILLA-IQELLDNPNIKDPAQEEPYKVYMRDRKEY 221 >UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 170 Score = 62.9 bits (146), Expect = 3e-09 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 12/106 (11%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG + ++ PD YP P++ F+ ++HPNI +G VC+ +++ Y+ + Sbjct: 49 TPYEGGYYPAVLNFPDDYPNNPPTMKFICPMFHPNIKN-TGEVCISILHPPGKDQYEYED 107 Query: 364 IFESFLP------------QLLTYPNPIDPLNGDAAAMYLHKPEEY 465 E +LP +L+ PNP P+N +AA +Y + +EY Sbjct: 108 KSERWLPIHTVESIIISVLSMLSDPNPESPMNIEAAKIYKNDIDEY 153 >UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein 10; n=41; Eukaryota|Rep: Constitutive photomorphogenesis protein 10 - Arabidopsis thaliana (Mouse-ear cress) Length = 182 Score = 62.9 bits (146), Expect = 3e-09 Identities = 26/94 (27%), Positives = 52/94 (55%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGG++ + + P YPFK P + F ++YH N+D +G + ++++ +W+ ++ Sbjct: 78 TPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVD-TAGDLSVNILRDSWSPALTITK 136 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + ++ + + P P P A +YL E++ Sbjct: 137 VLQA-IRSIFLKPEPYSPALPVIARLYLTDREKH 169 >UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 251 Score = 62.5 bits (145), Expect = 4e-09 Identities = 31/94 (32%), Positives = 50/94 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G++R+++ L +P P FM K++HPN+ +G +C++ + + W L + Sbjct: 52 TPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVAS-NGEICVNTLKKDWNPSLGLRH 110 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LL P P LN A M L +EY Sbjct: 111 VL-SVVRCLLIEPFPESALNEQAGKMLLENYDEY 143 >UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 186 Score = 62.1 bits (144), Expect = 6e-09 Identities = 32/89 (35%), Positives = 47/89 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T + G + V + YP + P + K+YHPNID + G VCL+++ W + +L N Sbjct: 73 TYWGGAKYLFTVEVGADYPHQPPKVHCHTKIYHPNID-LQGNVCLNILRADWKPVLNLYN 131 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 I L L PNP DPLN AA+ ++ Sbjct: 132 IISGVL-FLFIEPNPNDPLNKQAASQMIN 159 >UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 172 Score = 62.1 bits (144), Expect = 6e-09 Identities = 36/106 (33%), Positives = 52/106 (49%), Gaps = 12/106 (11%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYE G+++ R+ P YP P F +K++HPNIDE +G VC+ +++ Y + Sbjct: 49 TPYENGIFKGRMLFPTDYPDSPPKFRFCSKMWHPNIDE-NGNVCISILHNPGEDEYGYES 107 Query: 364 IFESFLP------------QLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + +LP LLT PN P N DAA EY Sbjct: 108 LGDRWLPVRTPESVILSIITLLTSPNCESPANVDAAQHLRENEREY 153 >UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomycota|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 190 Score = 62.1 bits (144), Expect = 6e-09 Identities = 32/89 (35%), Positives = 49/89 (55%), Gaps = 2/89 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTALYDL 357 T +EGG++++ V PD YP K P F+ ++HPN+ SGTVCL ++N +AW + Sbjct: 83 TLWEGGLFKLDVVFPDEYPTKPPKCKFVPPLFHPNV-YPSGTVCLSILNEEEAWKPAITI 141 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 I + LL PNP P +A ++ Sbjct: 142 KQILLG-IQDLLDDPNPESPAQAEAYNLF 169 >UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=12; Mammalia|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Mus musculus (Mouse) Length = 152 Score = 62.1 bits (144), Expect = 6e-09 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 1/94 (1%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLSN 363 PY ++VR+ P YPFK P++ F K+YHPN+ E G VCL +I N+ W Sbjct: 44 PYGLKAFQVRIDFPREYPFKPPTLRFTTKIYHPNVRE-DGLVCLPLISNENWKPYTKPYQ 102 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + E+ L L++ PN +P+ + A + PE + Sbjct: 103 VLEA-LNVLVSKPNLEEPVRLELADLLTQNPEMF 135 >UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmodium chabaudi|Rep: Ubiquitin carrier protein - Plasmodium chabaudi Length = 118 Score = 61.7 bits (143), Expect = 8e-09 Identities = 29/83 (34%), Positives = 46/83 (55%) Frame = +1 Query: 217 VHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLT 396 + D YP P I +NK++HPNIDE +G VCL+V+ W + +L + + LL Sbjct: 26 IKFKDTYPITPPKISCLNKIFHPNIDE-NGNVCLNVLKLDWNPIINLQMLILGLI-LLLN 83 Query: 397 YPNPIDPLNGDAAAMYLHKPEEY 465 P+ DP N DAA + + +++ Sbjct: 84 EPSTNDPFNADAANVLKNDKQKF 106 >UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 147 Score = 60.9 bits (141), Expect = 1e-08 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 1/93 (1%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-AWTALYDLSNI 366 Y G ++V PD+YPFK P F ++HPN+ + G VC +++ + W + + Sbjct: 43 YHGHNFKVICSFPDNYPFKMPDFAFETMIWHPNVTD-KGEVCKEMLGEKEWVPTKQVKTV 101 Query: 367 FESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 E + +L PN +N +AA Y P+E+ Sbjct: 102 IE-IIASMLAEPNVDSAINNEAAKQYKSDPKEF 133 >UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Homo sapiens (Human) Length = 158 Score = 60.9 bits (141), Expect = 1e-08 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI--NQAWTALYDL 357 TP+EGG++++R+ D YP P F ++HPN+ SGTVCL ++ ++ W + Sbjct: 51 TPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNV-YPSGTVCLSILEEDKDWRPAITI 109 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + +LL PN DP +A +Y EY Sbjct: 110 KQILLG-IQELLNEPNIQDPAQAEAYTIYCQNRVEY 144 >UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E2 L460; n=1; Acanthamoeba polyphaga mimivirus|Rep: Probable ubiquitin-conjugating enzyme E2 L460 - Mimivirus Length = 158 Score = 60.9 bits (141), Expect = 1e-08 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 1/93 (1%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-AWTALYDLSNI 366 YE + + + L + YP+ SP + F+ + H N+++ G +CL+++ + W A ++ +I Sbjct: 51 YENYNFELEIELSNDYPYSSPKVKFITPIQHMNVND-KGDICLNILKKDGWNASLNIISI 109 Query: 367 FESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 S + LL PNP DP N + A++Y + Y Sbjct: 110 IWSII-VLLDQPNPEDPFNSELASLYRNDKLSY 141 >UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 60.5 bits (140), Expect = 2e-08 Identities = 32/92 (34%), Positives = 53/92 (57%), Gaps = 5/92 (5%) Frame = +1 Query: 175 LQVTPYEGGVWR-----VRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW 339 +++ P EG +W+ + D YPF+ P++ K++HPNI ++ G VCL+++ + + Sbjct: 45 IRIHPSEG-IWKNGNFDFEFTMTDEYPFERPAVQCKTKLWHPNI-QLYGPVCLNILREKY 102 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAA 435 T LSN+ + L PNP DPLN +AA Sbjct: 103 TPAIPLSNLILG-IQYLFLEPNPNDPLNVEAA 133 >UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 159 Score = 60.1 bits (139), Expect = 2e-08 Identities = 32/96 (33%), Positives = 49/96 (51%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA--WTALYDL 357 TP+EGG++++R+ D YP P F ++HPN+ SGTVCL ++++ W + Sbjct: 51 TPWEGGLYKLRMIFKDDYPTSPPKCKFEPPLFHPNV-YPSGTVCLSLLDEEKDWRPAITI 109 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + LL PN DP +A +Y EY Sbjct: 110 KQILLG-IQDLLNEPNIKDPAQAEAYTIYCQNRLEY 144 >UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 155 Score = 60.1 bits (139), Expect = 2e-08 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 5/89 (5%) Frame = +1 Query: 199 GVWR-----VRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 G+W+ ++ +P+ +P P + + K++HPNIDE G +CL++I + + Sbjct: 49 GIWKDHNFDLKFDVPEEFPIAPPHVTLLTKIWHPNIDE-EGNICLNIIKGDYNPTITILQ 107 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 I + + + PNP PLN AA M +H Sbjct: 108 IIQG-IELIFVTPNPYSPLNNAAAEMLIH 135 >UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2-20K - Encephalitozoon cuniculi Length = 151 Score = 60.1 bits (139), Expect = 2e-08 Identities = 23/60 (38%), Positives = 39/60 (65%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 YEG V R ++ +P+ YPFK P + ++ V+HPN+D+ G VC++++ W + L +IF Sbjct: 54 YEGRVLRFKLKIPNAYPFKPPKLLCLDNVFHPNVDD-DGNVCMEILRLGWRPSHGLESIF 112 >UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 226 Score = 59.7 bits (138), Expect = 3e-08 Identities = 30/82 (36%), Positives = 44/82 (53%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+GG + + YP P + VYHPNID + G VCL+++ + W + +++I Sbjct: 114 YKGGKFVFSFKVGQGYPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII 172 Query: 370 ESFLPQLLTYPNPIDPLNGDAA 435 L L PNP DPLN +AA Sbjct: 173 YG-LQYLFLEPNPEDPLNKEAA 193 >UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4; n=4; Saccharomycetales|Rep: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 568 Score = 59.7 bits (138), Expect = 3e-08 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 3/88 (3%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGF--MNKVYHPNIDEVSGTVCLDVINQ-AWTALYDLS 360 Y G WR+ + +P YP P I F + HPNI+ +G +CLD++ Q W+ ++L Sbjct: 54 YYNGKWRLNITVPTTYPLTPPKIEFDKSTPICHPNINIDTGEICLDILKQEGWSPAWNLQ 113 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + + L L+ P P PLN D A ++ Sbjct: 114 YLVVAIL-MLIDDPEPDSPLNIDLANLF 140 >UniRef50_Q9VUR4 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 341 Score = 59.3 bits (137), Expect = 4e-08 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 13/100 (13%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----------- 330 T Y+GG ++ + P YP+ PSI F+ KV+HPN+ E +G +C+ +++ Sbjct: 105 TLYQGGYFKAHMKFPHDYPYSPPSIRFLTKVWHPNVYE-NGDLCISILHPPVDDPQSGEL 163 Query: 331 --QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + W ++ I S + LL PN P N DA+ MY Sbjct: 164 PCERWNPTQNVRTILLSVI-SLLNEPNTFSPANVDASVMY 202 >UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 185 Score = 59.3 bits (137), Expect = 4e-08 Identities = 28/92 (30%), Positives = 46/92 (50%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 + GGV V + YP P + K++HPNID + G VCL+++ + W + L ++ Sbjct: 73 WAGGVIVFTVSISLEYPMVPPKVLCKKKIFHPNID-LEGKVCLNILREDWRPVSSLKDVI 131 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 NP DPLN +AA + L +++ Sbjct: 132 FGLQMLFTQLTNPTDPLNKEAAELMLKDQQQF 163 >UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_7, whole genome shotgun sequence - Paramecium tetraurelia Length = 1164 Score = 59.3 bits (137), Expect = 4e-08 Identities = 28/94 (29%), Positives = 50/94 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY G++ + + P +P + P + F+ +YH NI+ G +C ++ + +T + Sbjct: 1017 TPYSNGIYILYMKFPQEFPLQPPDLRFLTSIYHCNINS-QGRICHSILGRNYTPDTKVIQ 1075 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 IFE+ L+T P P DPL+ A+ Y+ + Y Sbjct: 1076 IFEAVYGLLMT-PEPDDPLDTTIASEYMQDLKLY 1108 >UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 185 Score = 58.8 bits (136), Expect = 5e-08 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 2/83 (2%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDV--INQAWTALYDLSN 363 Y+GG W P YP P + + +YHPNID + G VCL +++ W+ + L++ Sbjct: 72 YQGGKWSFLFECPRDYPNNPPKVTCVTPIYHPNID-LEGHVCLSTLRLDKDWSPVSTLNH 130 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 + L L PNP DPLN +A Sbjct: 131 VVCGLL-SLFLEPNPDDPLNTEA 152 >UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 323 Score = 58.8 bits (136), Expect = 5e-08 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 12/104 (11%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA----------- 336 Y GG ++ ++ PD +PF P F +YHPN+ G +C+ +++Q+ Sbjct: 55 YHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNVYR-DGRLCISILHQSGDPMTDELDAE 113 Query: 337 -WTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 W+ + + ++ S + LL PN P N DAA Y PE+Y Sbjct: 114 TWSPVQTVESVLISIV-SLLEDPNISSPANVDAAVDYRKNPEQY 156 >UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellomyces capsulatus NAm1|Rep: Ubiquitin carrier protein - Ajellomyces capsulatus NAm1 Length = 198 Score = 58.8 bits (136), Expect = 5e-08 Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +1 Query: 190 YEGGVWRVRVHLPDH-YPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNI 366 Y+GG ++ +P+H YPF+ P + ++YHPNID G VCL+++ WTA D+ + Sbjct: 78 YKGGSFKFNFDIPEHDYPFEPPRVKCTQRIYHPNIDP-QGNVCLNILRDGWTAALDVQAV 136 >UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia guilliermondii|Rep: Ubiquitin carrier protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 439 Score = 58.8 bits (136), Expect = 5e-08 Identities = 27/95 (28%), Positives = 52/95 (54%), Gaps = 3/95 (3%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNK--VYHPNIDEVSGTVCLDVI-NQAWTALYDLS 360 Y G W++ + LP YP P + F + + HPN+D +G +CLD++ +++W+ + + Sbjct: 53 YYHGQWKLDIRLPIQYPQVPPKVWFSKETPILHPNVDFGTGEICLDILKSESWSPAWTIE 112 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + L L+ P P PLN D A ++ + + + Sbjct: 113 YVVVAIL-MLIDDPEPDSPLNLDLANLFRYDKDAF 146 >UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=2; African swine fever virus|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - African swine fever virus (strain BA71V) (ASFV) Length = 215 Score = 58.8 bits (136), Expect = 5e-08 Identities = 31/95 (32%), Positives = 49/95 (51%), Gaps = 8/95 (8%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--------QAW 339 T YEGG+++ +V P YP+ P + F ++++HPNI G +C+ +++ W Sbjct: 43 TLYEGGLFKAKVAFPPEYPYAPPKLTFTSEMWHPNI-YPDGRLCISILHGDNAEEQGMTW 101 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + + I S + LL PNP P N DAA Y Sbjct: 102 SPAQKIDTILLSVI-SLLNEPNPDSPANVDAAKSY 135 >UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_113, whole genome shotgun sequence - Paramecium tetraurelia Length = 155 Score = 58.4 bits (135), Expect = 7e-08 Identities = 29/96 (30%), Positives = 47/96 (48%) Frame = +1 Query: 178 QVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDL 357 +++PYE G + + V P YP P +NK+YH N+++ G + L+ + + W+ + Sbjct: 42 KLSPYEKGQFFILVEFPKEYPNIPPKFRILNKIYHMNVNQ-QGCIALNTLKKEWSESIGV 100 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + L L PNP +PLN A Y EY Sbjct: 101 KKMLLEIL-SLFQKPNPQNPLNLKLAQQYQEDCSEY 135 >UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Caenorhabditis elegans Length = 166 Score = 58.4 bits (135), Expect = 7e-08 Identities = 31/96 (32%), Positives = 49/96 (51%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI--NQAWTALYDL 357 T +EGG++R+R+ D +P P F ++HPN+ SGTVCL ++ N+ W + Sbjct: 51 TIWEGGLYRIRMLFKDDFPSTPPKCKFEPPLFHPNV-YPSGTVCLSLLDENKDWKPSISI 109 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + LL +PN DP +A +Y EY Sbjct: 110 KQLLIG-IQDLLNHPNIEDPAQAEAYQIYCQNRAEY 144 >UniRef50_A7RTQ5 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 181 Score = 58.0 bits (134), Expect = 9e-08 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 2/96 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTALYDL 357 T +EGG++++ + + + P + F +HPN+D V+G CLD ++ W Y L Sbjct: 27 TLWEGGIFKLYLQFDEGFNDIPPKVYFHTIPFHPNVDPVTGIPCLDFLDDYDQWKEYYSL 86 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + I S + +L+ P D +N DAA MY P Y Sbjct: 87 NYILLS-IQMMLSNPVLKDAVNADAAQMYRSSPGAY 121 >UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1; Bigelowiella natans|Rep: Ubiquitin conjugating enzyme E2 2 - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 154 Score = 57.6 bits (133), Expect = 1e-07 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSP-SIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 TPYE G++ V PD YP P I K+YHPNID G +C + W++ + Sbjct: 49 TPYESGMFFFNVEFPDTYPGHPPKKIKCSTKIYHPNIDS-KGQICFQGLKDTWSSSMNAK 107 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++ + F+ L+ P+ D +N + A E++ Sbjct: 108 SVIQ-FIIDLINNPDCGDAINSEVAKCMQEDMEKF 141 >UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypanosoma|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 251 Score = 57.6 bits (133), Expect = 1e-07 Identities = 30/94 (31%), Positives = 49/94 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+ GG ++V H + YP P F K++HPNI E G +C++V+ + W L + Sbjct: 47 TPFAGGSFQVVFHFDEGYPEVPPRGVFRTKIFHPNIAE-KGDICVNVLKRDWNPSLGLRH 105 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + + LL PN LN +AA + + + Y Sbjct: 106 VL-TIVRCLLIEPNAESALNEEAARLLMEDYDAY 138 >UniRef50_Q8SSK3 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 216 Score = 57.6 bits (133), Expect = 1e-07 Identities = 32/106 (30%), Positives = 53/106 (50%), Gaps = 14/106 (13%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ------------ 333 Y G + + + P YP + P++ F++K++HPNI E G +C+ ++ + Sbjct: 80 YAGRILKAVMKFPSSYPLRPPTLKFVSKMFHPNIYE-DGKMCISILEEDKQQDSSVFGDP 138 Query: 334 --AWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 WT + ++ I S + +L PN P N DA+ MY PEEY Sbjct: 139 KDKWTPVQNIRTIVMSIV-VILNSPNISSPANVDASVMYRDNPEEY 183 >UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 158 Score = 57.2 bits (132), Expect = 2e-07 Identities = 26/85 (30%), Positives = 45/85 (52%), Gaps = 1/85 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-AWTALYDLS 360 +PY G + V +P YP P F ++HPN+ +G +CL+++ + W+ L Sbjct: 48 SPYSGQTHTISVKIPRDYPLSPPECNFTTPMFHPNVKFANGEICLNILTKDDWSPAISLI 107 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAA 435 ++ +S + L + PN PLN DA+ Sbjct: 108 SLAQS-IAGLCSAPNTDSPLNCDAS 131 >UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 164 Score = 57.2 bits (132), Expect = 2e-07 Identities = 32/100 (32%), Positives = 54/100 (54%), Gaps = 13/100 (13%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----------- 330 T +EGG++R + PD+YP + P F+ ++HPNI G+VC+ +++ Sbjct: 46 TLFEGGLFRAELRFPDNYPDQPPKFVFITDIFHPNIYS-DGSVCISILHPPGPDPHQYET 104 Query: 331 --QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + W ++ +S+I S + LL+ PN P N DAA +Y Sbjct: 105 AAERWLPVHTVSSIILSVI-SLLSDPNCKSPANVDAAKLY 143 >UniRef50_Q5DD88 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 289 Score = 57.2 bits (132), Expect = 2e-07 Identities = 22/50 (44%), Positives = 37/50 (74%) Frame = +1 Query: 181 VTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN 330 +T YEGG ++ R+ PD YP+ P++ FM+++YHPNI E +G VC+ +++ Sbjct: 51 MTLYEGGYFKARLCFPDDYPYSPPTMHFMSRMYHPNIYE-NGEVCISILH 99 >UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 190 Score = 57.2 bits (132), Expect = 2e-07 Identities = 26/76 (34%), Positives = 44/76 (57%) Frame = +1 Query: 217 VHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLT 396 + +P YPFK P + ++K+ HPNID++ G VC+++I + W +S + L LL Sbjct: 102 IRVPKEYPFKPPKVKCLSKILHPNIDKL-GHVCINIIREDWKPTLTISIVICGLL-NLLI 159 Query: 397 YPNPIDPLNGDAAAMY 444 P+ DP N A+ ++ Sbjct: 160 EPSNSDPFNEFASILF 175 >UniRef50_A0D4V6 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 149 Score = 57.2 bits (132), Expect = 2e-07 Identities = 29/89 (32%), Positives = 45/89 (50%), Gaps = 2/89 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI--NQAWTALYDL 357 T Y+GG +++ + P++YPFK+P F K++HPNI E G C D+I W + Sbjct: 43 TAYQGGKFKLSITFPENYPFKAPQFLFTTKIFHPNITE-KGEFCEDMIETKDQWQPTKTV 101 Query: 358 SNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + E L ++ N LN A +Y Sbjct: 102 KQVLEKIL-NIMGQVNTEQALNQKAMELY 129 >UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 159 Score = 57.2 bits (132), Expect = 2e-07 Identities = 27/94 (28%), Positives = 50/94 (53%), Gaps = 2/94 (2%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNI-DEVSGTVCLDVIN-QAWTALYDLSN 363 Y GG +++ ++ P+ YPFK P + F K+YHPN+ ++ G++CL ++ ++W + Sbjct: 54 YAGGHFKLEINFPNEYPFKPPVVSFRTKIYHPNVTNDDKGSMCLGLLRPESWKPPNKVVA 113 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + LL PN D + A Y +E+ Sbjct: 114 VLR-LIQTLLIEPNVDDAIEPSIANEYRENRKEF 146 >UniRef50_A7EC39 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 169 Score = 57.2 bits (132), Expect = 2e-07 Identities = 26/84 (30%), Positives = 42/84 (50%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y G W + + LP +YP +P I F+ K+ HPN+ +G +CLDV+ WT + + Sbjct: 57 YLTGRWLLSISLPSNYPIGAPKIKFVTKICHPNVKWETGEICLDVLADKWTPVLGVVGAL 116 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAM 441 E + + PLN + A + Sbjct: 117 ECVGALVAGGGDETSPLNVEIARL 140 >UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; Eukaryota|Rep: NEDD8-conjugating enzyme Ubc12 - Homo sapiens (Human) Length = 183 Score = 57.2 bits (132), Expect = 2e-07 Identities = 29/82 (35%), Positives = 43/82 (52%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+ G + + YP P + VYHPNID + G VCL+++ + W + +++I Sbjct: 71 YKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNID-LEGNVCLNILREDWKPVLTINSII 129 Query: 370 ESFLPQLLTYPNPIDPLNGDAA 435 L L PNP DPLN +AA Sbjct: 130 YG-LQYLFLEPNPEDPLNKEAA 150 >UniRef50_Q6E689 Cluster: Ubiquitin carrier protein; n=1; Antonospora locustae|Rep: Ubiquitin carrier protein - Antonospora locustae (Nosema locustae) Length = 155 Score = 56.8 bits (131), Expect = 2e-07 Identities = 22/62 (35%), Positives = 38/62 (61%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +E G + + + + YP P + F++KV+HPN+ SG +CLD++ W+ YD+ N Sbjct: 48 TFFEDGTFSLILSFKESYPQSPPEVKFVSKVFHPNV-YASGDLCLDILKNRWSPTYDVCN 106 Query: 364 IF 369 +F Sbjct: 107 LF 108 >UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=3; Saccharomycetales|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 183 Score = 56.8 bits (131), Expect = 2e-07 Identities = 28/84 (33%), Positives = 47/84 (55%), Gaps = 2/84 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFM-NKVYHPNIDEVSGTVCLDVIN-QAWTALYDL 357 TPYE +R+ + +P YP P I FM N + H N+ +G +CL+++ + WT ++DL Sbjct: 71 TPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDL 130 Query: 358 SNIFESFLPQLLTYPNPIDPLNGD 429 + + + +LL P PL+ D Sbjct: 131 LHCVHA-VWRLLREPVCDSPLDVD 153 >UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa; n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 295 Score = 56.8 bits (131), Expect = 2e-07 Identities = 30/104 (28%), Positives = 51/104 (49%), Gaps = 12/104 (11%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA----------- 336 Y GG ++ ++ P+ +PF P F +YHPN+ G +C+ +++Q+ Sbjct: 55 YHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNVYR-DGRLCISILHQSGDPMTDEPDAE 113 Query: 337 -WTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 W+ + + ++ S + LL PN P N DAA Y PE+Y Sbjct: 114 TWSPVQTVESVLISIV-SLLEDPNINSPANVDAAVDYRKNPEQY 156 >UniRef50_Q712K3 Cluster: Ubiquitin-conjugating enzyme E2 R2; n=61; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 R2 - Homo sapiens (Human) Length = 238 Score = 56.4 bits (130), Expect = 3e-07 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 13/100 (13%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI------------ 327 T YEGG ++ + P YP+ P+ F+ K++HPNI E +G VC+ ++ Sbjct: 51 TLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYE-NGDVCISILHPPVDDPQSGEL 109 Query: 328 -NQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMY 444 ++ W ++ I S + LL PN P N DA+ M+ Sbjct: 110 PSERWNPTQNVRTILLSVI-SLLNEPNTFSPANVDASVMF 148 >UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmodium|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 157 Score = 56.0 bits (129), Expect = 4e-07 Identities = 29/80 (36%), Positives = 44/80 (55%) Frame = +1 Query: 205 WRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLP 384 +R + + YP P I ++K++HPNIDE SG VCL+V+ W + +L + L Sbjct: 57 FRFVIKFKESYPITPPKIICLSKIFHPNIDE-SGNVCLNVLKLEWNPIINLQMLILGLL- 114 Query: 385 QLLTYPNPIDPLNGDAAAMY 444 LL P+ DP N AA ++ Sbjct: 115 LLLDEPSTDDPFNKIAAEVF 134 >UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 157 Score = 56.0 bits (129), Expect = 4e-07 Identities = 30/84 (35%), Positives = 50/84 (59%), Gaps = 2/84 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGF-MNKVYHPNIDEVSGTVCLDVINQA-WTALYDL 357 TPY G + +R+HL YP K P + F K+ H NI+ +G +CL++++ A W+ +++L Sbjct: 48 TPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNL 107 Query: 358 SNIFESFLPQLLTYPNPIDPLNGD 429 + + + QLL+ P PLN D Sbjct: 108 LTVVLA-IYQLLSDPVTDSPLNID 130 >UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria annulata Length = 170 Score = 55.6 bits (128), Expect = 5e-07 Identities = 33/108 (30%), Positives = 52/108 (48%), Gaps = 14/108 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI------------ 327 TPYEGG++ V + P+ +P P + F N+++HPNI G VC+ ++ Sbjct: 52 TPYEGGIFTVIMTFPEDFPNNPPEMFFKNQMWHPNI-YPDGRVCISILHPPGSDRYNEQE 110 Query: 328 --NQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 N+ W + + I S + +L PN P N DA + P+EY Sbjct: 111 LPNERWRPILGVETILISVI-SMLGEPNLESPANVDAGVQLKNDPKEY 157 >UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 130 Score = 55.6 bits (128), Expect = 5e-07 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 4/88 (4%) Frame = +1 Query: 172 DLQVTP----YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW 339 +LQ+TP Y GG ++ V D YP +PSI K+YHPN+D G VC+ +++ W Sbjct: 7 ELQITPTDGAYRGGQFKFSVRTTD-YPNVAPSINCKTKIYHPNMDGYDG-VCMSLLDD-W 63 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLN 423 A DL ++ + L L PN DPL+ Sbjct: 64 QASNDLEDLVQGLL-FLFYNPNLEDPLS 90 >UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergillus niger|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 185 Score = 55.6 bits (128), Expect = 5e-07 Identities = 22/69 (31%), Positives = 37/69 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG++ + + +P YP P FM K++HPN+ G VCL+++ W+ + Sbjct: 74 SPYEGGIFHIHIRIPALYPDLPPICTFMTKIWHPNVGPY-GEVCLNILQDEWSQALSVRT 132 Query: 364 IFESFLPQL 390 + S L Sbjct: 133 VLLSISAML 141 >UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo sapiens (Human) Length = 170 Score = 55.6 bits (128), Expect = 5e-07 Identities = 30/96 (31%), Positives = 49/96 (51%), Gaps = 12/96 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T YEGGV++ + P YP + P + F+ +++HPN+D+ +G VC+ ++++ Y Sbjct: 48 TLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDK-NGDVCISILHEPGEDKYGYEK 106 Query: 364 IFESFLP------------QLLTYPNPIDPLNGDAA 435 E +LP +L PN P N DAA Sbjct: 107 PEERWLPIHTVETIMISVISMLADPNGDSPANVDAA 142 >UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme morgue; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme morgue - Nasonia vitripennis Length = 522 Score = 55.2 bits (127), Expect = 7e-07 Identities = 28/89 (31%), Positives = 48/89 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGGV+ + + +P YP + P + F+ K+ HPN+ G V +D I+ W+ +S Sbjct: 411 SPYEGGVFYLYLQVPYSYPMRPPVVRFLTKILHPNVSR-HGDVGIDSIHHNWSLALTISK 469 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLH 450 + S + LLT P + + MY++ Sbjct: 470 VLIS-VQSLLTDPYCQVCMEPELGEMYMN 497 >UniRef50_UPI0000D57489 Cluster: PREDICTED: similar to CG15437-PA; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG15437-PA - Tribolium castaneum Length = 392 Score = 54.8 bits (126), Expect = 9e-07 Identities = 25/73 (34%), Positives = 42/73 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG++ + + +P YP P + F+ K++HPN+ G + +D I+ W+ LS Sbjct: 282 SPYEGGLFFLYIQVPTTYPLDPPLVRFITKIFHPNVSR-HGDIGIDSIHHNWSLALTLSK 340 Query: 364 IFESFLPQLLTYP 402 + S + LLT P Sbjct: 341 LLIS-IQSLLTDP 352 >UniRef50_UPI0000519DF4 Cluster: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial; n=1; Apis mellifera|Rep: PREDICTED: similar to modifier of rpr and grim, ubiquitously expressed CG15437-PA, partial - Apis mellifera Length = 481 Score = 54.8 bits (126), Expect = 9e-07 Identities = 28/94 (29%), Positives = 50/94 (53%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG++ + + +P YP P + F+ K+ HPN+ G V +D I+ W+ +S Sbjct: 370 SPYEGGLFYLYLQVPCSYPLYPPIVRFLTKILHPNVSR-HGDVGIDSIHHNWSLALTISK 428 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LLT P + + MY++ E++ Sbjct: 429 VLIS-VQSLLTDPYCQVCMEPELGEMYMNDREKF 461 >UniRef50_Q9Y165 Cluster: CG15437-PA; n=4; Sophophora|Rep: CG15437-PA - Drosophila melanogaster (Fruit fly) Length = 491 Score = 54.8 bits (126), Expect = 9e-07 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-AWTALYDLS 360 +PYEGG + + ++ P+ YP P++ F+ K+ HPN+ G V +D+ Q W+ +++ Sbjct: 379 SPYEGGKFFLFIYFPERYPMTPPTVRFLTKILHPNVSR-HGDVGIDIFQQHNWSLALNVA 437 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + S + LLT P + + +Y H+ E + Sbjct: 438 KVLLS-VQSLLTDPYTEVCMEPELGYIYEHERERF 471 >UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/Metazoa group|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 180 Score = 54.4 bits (125), Expect = 1e-06 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 13/107 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----------- 330 T YEGG ++ + P YP + P + F+ +++HPNID+ +G VC+ +++ Sbjct: 60 TLYEGGFFKAHLIFPKEYPLRPPKMKFITEIWHPNIDK-AGDVCISILHEPGDDKWGYEK 118 Query: 331 --QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + W ++ + I S + +LT PN N DAA Y E+ Sbjct: 119 AEERWLPVHTVETILLSVI-SMLTDPNDESAANVDAAKEYRENYAEF 164 >UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 423 Score = 54.4 bits (125), Expect = 1e-06 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 10/106 (9%) Frame = +1 Query: 172 DLQVTPYEGGVW-----RVRVHLPDHYPFKSPSIGFMNKVYHPNI-----DEVSGTVCLD 321 +L VT EG +W + + +P+ YP + + ++ + HPNI + +G VCL+ Sbjct: 309 ELTVTASEG-IWQGIPIKFQCVIPEGYPHERLRVKCLSSIRHPNILGANAPKCAGAVCLN 367 Query: 322 VINQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 ++ + W +Y + L LL P PI+PL+ +AA + + PE Sbjct: 368 IVREDWRPVYTVGTAALGLL-NLLVEPQPIEPLDAEAAELLVSNPE 412 >UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 219 Score = 54.0 bits (124), Expect = 2e-06 Identities = 32/107 (29%), Positives = 51/107 (47%), Gaps = 13/107 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI------------ 327 TPYEGGV+ +R+ PD +P P + F ++ +HPN+ G VC+ ++ Sbjct: 45 TPYEGGVFNLRMFFPDDFPSNPPKLVFKSEFWHPNV-YPDGKVCISILHPPGEDEMSGEL 103 Query: 328 -NQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++ W +S+I S + +L PN P N DA +EY Sbjct: 104 ASERWLPTQSVSSILLS-VQSMLCDPNMYSPANTDAMVQCRDHNKEY 149 >UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishmania|Rep: Ubiquitin carrier protein - Leishmania major Length = 243 Score = 54.0 bits (124), Expect = 2e-06 Identities = 29/94 (30%), Positives = 47/94 (50%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TP+ G + V + + YP P F K++HPNI E G +C++ + + W+ + L + Sbjct: 47 TPFAAGRFHVVLIFDEQYPEVPPKGFFRTKIFHPNISE-RGDICVNTLKRDWSPMLGLRH 105 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + LL PNP LN +A + L + Y Sbjct: 106 IL-VVIRCLLIEPNPESALNEEAGRLILEEYAAY 138 >UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24; n=2; Caenorhabditis|Rep: Putative uncharacterized protein ubc-24 - Caenorhabditis elegans Length = 160 Score = 54.0 bits (124), Expect = 2e-06 Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 1/93 (1%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQA-WTALYDLSNI 366 Y+ ++ + + + YPFK P + F + VYHPN+D V+ +C ++ Q W + ++ Sbjct: 57 YKNMIFTLTLDVNVEYPFKPPYLKFCHNVYHPNVDPVTCELCSPMLLQENWKPETTMEDV 116 Query: 367 FESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + LL P+ P+N DAA Y+H E+ Sbjct: 117 LLNLI-VLLNEPDLSRPVNIDAAHDYIHNKVEF 148 >UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU04513.1; n=4; Sordariomycetes|Rep: Putative uncharacterized protein NCU04513.1 - Neurospora crassa Length = 204 Score = 53.6 bits (123), Expect = 2e-06 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 2/94 (2%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVS-GTVCLDVI-NQAWTALYDLSN 363 Y G + + + LP YPFK P+I F ++YHPNI S G +CL ++ ++ W + + Sbjct: 47 YAPGRFGLILKLPTDYPFKPPTINFTTRIYHPNITNDSLGNICLGLLKSENWKPASKIIS 106 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + E+ + +L P P D L A Y E+ Sbjct: 107 VLEA-VRNILVEPMPDDALEQRIADEYRRDRPEF 139 >UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep: F15O4.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 123 Score = 53.2 bits (122), Expect = 3e-06 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 23/102 (22%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFM-----------------NKVYHPNIDEVSGTV 312 TPY G++R+ + P+ YPFK P + F+ +YH NI + SG++ Sbjct: 8 TPYASGIFRLDIEFPEDYPFKPPKVNFVVYNINTFYDLFFNSTFKTPIYHSNI-KSSGSI 66 Query: 313 CLDVINQAWT------ALYDLSNIFESFLPQLLTYPNPIDPL 420 C+D++ WT L + S++ S + LL PNP DPL Sbjct: 67 CIDILKDKWTPSLTVEKLINKSHVLLS-ITVLLADPNPNDPL 107 >UniRef50_A0CVS4 Cluster: Chromosome undetermined scaffold_295, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_295, whole genome shotgun sequence - Paramecium tetraurelia Length = 152 Score = 53.2 bits (122), Expect = 3e-06 Identities = 28/87 (32%), Positives = 46/87 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PY+ ++ + YP P + FMNK++HPNI+ V G + L ++ WT+ Y + Sbjct: 46 SPYKNYLFFLNFQFSIEYPQIPPQVTFMNKIFHPNIN-VLGYIYLGILKDDWTSDYTVHK 104 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 I S + QLL P+ + DA +Y Sbjct: 105 ILTS-IKQLLKNPDEDNSFFPDATLLY 130 >UniRef50_UPI0000F2DAA5 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 151 Score = 52.8 bits (121), Expect = 4e-06 Identities = 26/74 (35%), Positives = 40/74 (54%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNI 366 PY +R R+ P +YP+K P + F+ +YHP + E +G VCL ++ W A + + Sbjct: 45 PYNLRAFRFRITFPRNYPYKPPQLNFVTSIYHPQVTE-NGEVCLPSLHSNWKA-HTTIHQ 102 Query: 367 FESFLPQLLTYPNP 408 S LP LL+ P Sbjct: 103 APSRLPPLLSEEIP 116 >UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 160 Score = 52.8 bits (121), Expect = 4e-06 Identities = 28/92 (30%), Positives = 45/92 (48%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y+ ++ V + YP +P + K++HPNID GT+C++ I + L I Sbjct: 52 YKEDIFVVEIEFQPEYPQSAPRTTMLTKIFHPNID-TDGTICINAIRGGYFPGQSLVQII 110 Query: 370 ESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 E + L PNP D LN +AA + E++ Sbjct: 111 EE-VKMALKDPNPDDYLNREAAQLMKSDIEQF 141 >UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11; Eutheria|Rep: Ubiquitin-conjugating enzyme E2 U - Homo sapiens (Human) Length = 321 Score = 52.8 bits (121), Expect = 4e-06 Identities = 28/99 (28%), Positives = 54/99 (54%), Gaps = 2/99 (2%) Frame = +1 Query: 175 LQVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTAL 348 LQ + ++G V+++ +H Y + P + F+ +HPN+D +G C+D ++ + W Sbjct: 43 LQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN 102 Query: 349 YDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 Y LS+I + L +L+ P +P+N +AA + + Y Sbjct: 103 YTLSSILLA-LQVMLSNPVLENPVNLEAARILVKDESLY 140 >UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 517 Score = 52.4 bits (120), Expect = 5e-06 Identities = 31/107 (28%), Positives = 52/107 (48%), Gaps = 13/107 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----------- 330 T YEGGV+++ + P YP PS+ F++ +HPN+ G VC+ +++ Sbjct: 65 TCYEGGVFQLLLTFPKDYPMSPPSLRFLSDFWHPNVYIREGRVCISILHPPGDDILSGEL 124 Query: 331 --QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + W ++ I S L +L+ PN P N DA+ + E+Y Sbjct: 125 PEERWLPTQSVTTIILS-LMSILSDPNCSSPANVDASVEWRTDKEQY 170 >UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=2; Culicidae|Rep: Ubiquitin-conjugating enzyme morgue - Aedes aegypti (Yellowfever mosquito) Length = 392 Score = 52.4 bits (120), Expect = 5e-06 Identities = 25/73 (34%), Positives = 40/73 (54%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYEGG + + + +P YP P + F+ K+ HPN+ G V +D+I W+ +S Sbjct: 277 SPYEGGKFFLYIVIPCSYPMLPPQVRFLTKIVHPNVSR-HGDVGIDIIQHNWSLALTISK 335 Query: 364 IFESFLPQLLTYP 402 + S + LLT P Sbjct: 336 LLLS-VQSLLTDP 347 >UniRef50_A7F3W6 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 632 Score = 52.4 bits (120), Expect = 5e-06 Identities = 20/46 (43%), Positives = 28/46 (60%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLD 321 TPYEGG++ + + DHYP + P + F K+YHPNI C+D Sbjct: 450 TPYEGGIFWITFKITDHYPDQLPLMRFNTKIYHPNISPQGYVCCID 495 >UniRef50_Q7QWL1 Cluster: GLP_762_41239_41676; n=1; Giardia lamblia ATCC 50803|Rep: GLP_762_41239_41676 - Giardia lamblia ATCC 50803 Length = 145 Score = 52.0 bits (119), Expect = 6e-06 Identities = 23/71 (32%), Positives = 40/71 (56%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 +PYE ++ V + + YP P+I F +++ HPNI + G VC +++N+ WT + + Sbjct: 43 SPYEACLFHVHLSIGREYPISPPTITFNSRILHPNISD-RGLVCPNLVNKDWTHTMGIQD 101 Query: 364 IFESFLPQLLT 396 + E LLT Sbjct: 102 LMELLQDILLT 112 >UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohymenophorea|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 233 Score = 52.0 bits (119), Expect = 6e-06 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 12/106 (11%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN----------- 330 T YEGG ++ + P+ YP P+ F+ +++HPNI G VC+ +++ Sbjct: 115 TLYEGGYFQAIMKFPEDYPNSPPTFKFLTEMWHPNIYS-DGRVCISILHAQDEFNDQEPP 173 Query: 331 -QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 W + ++ S + +L+ PN P N DA + KP+EY Sbjct: 174 ETRWRPILTPEDVLISIV-SMLSEPNINSPANVDAGIQFRDKPDEY 218 >UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; Acanthamoeba polyphaga mimivirus|Rep: Putative uncharacterized protein - Mimivirus Length = 1297 Score = 51.6 bits (118), Expect = 8e-06 Identities = 27/87 (31%), Positives = 46/87 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPY+ G W + + YP +P+I F+ + H NI+ G VC ++++ +T +S Sbjct: 1175 TPYKNGTWLAYIQFTEEYPNIAPNIRFVTPIKHCNINNY-GRVCHSILDRNYTPNVKISL 1233 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMY 444 I + LL P+ DPL+ + A +Y Sbjct: 1234 ILQCIYGLLLN-PDVNDPLDTNLAMIY 1259 >UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a) - Homo sapiens (Human) Length = 122 Score = 51.6 bits (118), Expect = 8e-06 Identities = 22/54 (40%), Positives = 31/54 (57%) Frame = +1 Query: 304 GTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 G++CLD++ W+ YD+S+I S + LL PNP P N AA +Y EY Sbjct: 55 GSICLDILQNRWSPTYDVSSILTS-IQSLLDEPNPNSPANSQAAQLYQENKREY 107 >UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=2; Pichia|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Pichia pastoris (Yeast) Length = 204 Score = 43.2 bits (97), Expect(2) = 1e-05 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = +1 Query: 280 HPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAA 435 HPNI +G +CLD++ WT + LS+ + + LL P P+ PL+ D A Sbjct: 122 HPNIAFNTGEICLDILQAKWTPAWTLSSALTAIV-LLLNDPEPLSPLDIDMA 172 Score = 27.9 bits (59), Expect(2) = 1e-05 Identities = 8/28 (28%), Positives = 16/28 (57%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFM 267 T Y+ W +++ +P +YP + P F+ Sbjct: 56 TGYQDAFWELQIDIPSNYPTQPPKFTFI 83 >UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 269 Score = 51.2 bits (117), Expect = 1e-05 Identities = 26/95 (27%), Positives = 45/95 (47%), Gaps = 1/95 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPD-HYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS 360 TPY GG +R+ + +P P F ++HPN+ SG +C+ + + W Y + Sbjct: 103 TPYAGGYFRIAFDFTNVDFPTHPPRCTFATPIFHPNVSR-SGDICVSSLKKDWKKEYGIE 161 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 I + + LL PNP L+ +A+ + + Y Sbjct: 162 RILTT-IKCLLIEPNPDSALDAEASRLMQENWDHY 195 >UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin conjugating enzyme, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ubiquitin conjugating enzyme, partial - Strongylocentrotus purpuratus Length = 162 Score = 50.8 bits (116), Expect = 1e-05 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 13/100 (13%) Frame = +1 Query: 193 EGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-------------NQ 333 EGG ++ + P YP K P + F+++++HPNID+ G VC+ ++ ++ Sbjct: 1 EGGYFKAHLIFPKDYPNKPPKMKFVSEIWHPNIDK-EGDVCISILHEPGEDKWGYERPSE 59 Query: 334 AWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHK 453 W ++ + I S + +L PN P N DAA + K Sbjct: 60 RWLPIHTVETILISVI-SMLADPNDESPANVDAAVSIIPK 98 >UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 201 Score = 50.8 bits (116), Expect = 1e-05 Identities = 18/47 (38%), Positives = 33/47 (70%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN 330 YEGG++ R+ P++YP K PS+ F+ ++HPN+ +G VC+ +++ Sbjct: 84 YEGGIFSARLSFPENYPDKPPSMKFLTPIWHPNVYS-NGDVCISILH 129 >UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase; n=1; Arabidopsis thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase - Arabidopsis thaliana Length = 198 Score = 50.4 bits (115), Expect = 2e-05 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 13/107 (12%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI------------ 327 T YEGG + + P +YP P++ F + ++HPN+ G VC+ ++ Sbjct: 79 TLYEGGFFNAIMTFPQNYPNSPPTVRFTSDMWHPNVYS-DGRVCISILHPPGDDPSGYEL 137 Query: 328 -NQAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 ++ WT ++ + +I S + +L+ PN P N +AA + K +E+ Sbjct: 138 ASERWTPVHTVESIMLSII-SMLSGPNDESPANVEAAKEWRDKRDEF 183 >UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; Eumetazoa|Rep: NEDD8-conjugating enzyme UBE2F - Homo sapiens (Human) Length = 185 Score = 50.4 bits (115), Expect = 2e-05 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 10/107 (9%) Frame = +1 Query: 175 LQVTP----YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ--- 333 L VTP Y+GG ++ +PD Y P + + K++HPNI E +G +CL ++ + Sbjct: 67 LTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITE-TGEICLSLLREHSI 125 Query: 334 ---AWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 W L ++ N DPLN +AA +L E++ Sbjct: 126 DGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDF 172 >UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=19; Spermatophyta|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Arabidopsis thaliana (Mouse-ear cress) Length = 161 Score = 50.4 bits (115), Expect = 2e-05 Identities = 23/83 (27%), Positives = 46/83 (55%), Gaps = 1/83 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKV-YHPNIDEVSGTVCLDVINQAWTALYDLS 360 T Y ++++V P+HYP ++P + F++ HP+I +G +CLD++ +W+ ++ Sbjct: 56 TLYANETYQLQVEFPEHYPMEAPQVVFVSPAPSHPHIYS-NGHICLDILYDSWSPAMTVN 114 Query: 361 NIFESFLPQLLTYPNPIDPLNGD 429 ++ S L L + P P + D Sbjct: 115 SVCISILSMLSSSPAKQRPADND 137 >UniRef50_Q9XVK5 Cluster: NEDD8-conjugating enzyme ubc-12; n=3; Chromadorea|Rep: NEDD8-conjugating enzyme ubc-12 - Caenorhabditis elegans Length = 180 Score = 49.6 bits (113), Expect = 3e-05 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 10/108 (9%) Frame = +1 Query: 172 DLQVTP----YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-- 333 +L VTP Y GG +R ++ +P Y P + + KV+HPNI+E G++CL ++ Q Sbjct: 62 ELTVTPQEGIYRGGKFRFKITVPPEYNNVPPVVKCLTKVWHPNINE-DGSICLSILRQNS 120 Query: 334 ----AWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 W +L+++ + + D LN AA M+ E + Sbjct: 121 LDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNRESF 168 >UniRef50_UPI0000498382 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 152 Score = 49.2 bits (112), Expect = 4e-05 Identities = 32/103 (31%), Positives = 51/103 (49%), Gaps = 9/103 (8%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ-----AW--- 339 +PYEGG + V++ LP YP K P + M KVY P ++ T+C ++ W Sbjct: 42 SPYEGGKFEVKITLPKEYPHKPPMLVVMTKVYSPIVNPEDHTICHPILQTDNKPGNWAPT 101 Query: 340 TALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYL-HKPEEY 465 +++Y++ F S L L T D ++ A L +PEE+ Sbjct: 102 SSVYEVLVAFRSMLGSLST-----DHVSDTEVAQVLAERPEEF 139 >UniRef50_Q9ERK8 Cluster: Ubiquitin carrier protein; n=1; Mus musculus|Rep: Ubiquitin carrier protein - Mus musculus (Mouse) Length = 148 Score = 49.2 bits (112), Expect = 4e-05 Identities = 16/43 (37%), Positives = 33/43 (76%) Frame = +1 Query: 199 GVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI 327 G++++ + P+ YP KSP+I F+++++HPN+ G++CLD++ Sbjct: 99 GIFKLVIEFPEEYPNKSPTIRFLSRMFHPNV-YAGGSICLDIL 140 >UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 178 Score = 49.2 bits (112), Expect = 4e-05 Identities = 31/99 (31%), Positives = 47/99 (47%), Gaps = 5/99 (5%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSP--SIG-FMNKVYHPNIDEVSGTVCLDVI--NQAWTAL 348 TP+EGG++ + + P YP P +G F + HPN+ SGTVCL +I N+ W Sbjct: 55 TPWEGGLYPITLEFPHDYPHSPPKCKLGVFDPPILHPNV-FTSGTVCLSLIDKNKDWKPQ 113 Query: 349 YDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + LL PN +P +A +Y +Y Sbjct: 114 VTAQQVLTG-IQLLLADPNFQEPAQAEAFVIYTQSRLDY 151 >UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 203 Score = 49.2 bits (112), Expect = 4e-05 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%) Frame = +1 Query: 226 PDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-NQAWTALYDLSNIFESFLPQLLTYP 402 PD++P+ P + + K++HPNIDE G VCL + + + A + + + L LL P Sbjct: 87 PDNFPYIPPKVLCLTKIWHPNIDE-DGNVCLSTLRGETYLASTSIHAHYVA-LGFLLKNP 144 Query: 403 NPIDPLNGDAA 435 NP DPL+ + A Sbjct: 145 NPSDPLDANIA 155 >UniRef50_A2EXE5 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 148 Score = 48.8 bits (111), Expect = 6e-05 Identities = 33/90 (36%), Positives = 42/90 (46%), Gaps = 3/90 (3%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLS- 360 T YEG + V LP YPF+ PSI F +YHPN+D+ + N W Y Sbjct: 42 TAYEGYKPFLEVELPAKYPFEKPSIKFSPSIYHPNVDDEK-----LIGNFCWGEDYKTQM 96 Query: 361 NIFE--SFLPQLLTYPNPIDPLNGDAAAMY 444 +IFE +L PN P+N AA Y Sbjct: 97 HIFEIIQTAADILKNPNNASPINIKAAQEY 126 >UniRef50_Q9VZ73 Cluster: CG17030-PA; n=1; Drosophila melanogaster|Rep: CG17030-PA - Drosophila melanogaster (Fruit fly) Length = 180 Score = 48.4 bits (110), Expect = 8e-05 Identities = 24/94 (25%), Positives = 46/94 (48%), Gaps = 1/94 (1%) Frame = +1 Query: 187 PYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN-QAWTALYDLSN 363 PY+ G +++ + P YPFK P I ++YH N++E G VC+ ++ + W + Sbjct: 54 PYDKGAYKMEIDFPLDYPFKPPRIHINTRMYHLNVNE-RGQVCVPILEVEHWIPTTRIDQ 112 Query: 364 IFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + + L + P P + + + A Y + P + Sbjct: 113 VLQVLL-ATINDPQPENAWHIEMAGEYRNDPVRF 145 >UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 192 Score = 48.4 bits (110), Expect = 8e-05 Identities = 27/83 (32%), Positives = 40/83 (48%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +EG RV + P+ YP P + F ++HPN+ SG+VCL +++ W + Sbjct: 56 TIWEGCTLRVYMFFPEDYPIAPPKVQFDPTLFHPNV-YPSGSVCLSILSYEWKPSITIKE 114 Query: 364 IFESFLPQLLTYPNPIDPLNGDA 432 I L LL PN P +A Sbjct: 115 ILLG-LQVLLDEPNLQSPAQHEA 136 >UniRef50_Q0TYP6 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 1587 Score = 48.4 bits (110), Expect = 8e-05 Identities = 22/78 (28%), Positives = 42/78 (53%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 Y GG + + + + YP +P+ F+ +YHPNI+ G +C ++++ WT ++ Sbjct: 1473 YAGGTFLLYIDMGADYPMFAPTARFVTPIYHPNINR-HGRICHSILDRNWTVDTSNKDLL 1531 Query: 370 ESFLPQLLTYPNPIDPLN 423 ++ + LL P DP+N Sbjct: 1532 DT-IYSLLLVPEFSDPIN 1548 >UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative),; n=1; Monodelphis domestica|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative), - Monodelphis domestica Length = 313 Score = 47.6 bits (108), Expect = 1e-04 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 2/76 (2%) Frame = +1 Query: 226 PDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTALYDLSNIFESFLPQLLTY 399 PD Y + P++ F +HPN+D +G +D ++ AW + L +I S + ++L+Y Sbjct: 201 PD-YNYLPPAVAFNPVPFHPNVDPTTGKPSMDFLDDPNAWDRNHTLKSILLS-IQEMLSY 258 Query: 400 PNPIDPLNGDAAAMYL 447 P DP+N +AA M + Sbjct: 259 PTLHDPINLEAAQMII 274 >UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 162 Score = 47.6 bits (108), Expect = 1e-04 Identities = 26/76 (34%), Positives = 37/76 (48%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIF 369 +EGG +R+ + P YP +P F V H N+ SG VCL ++ W +L I Sbjct: 56 WEGGFYRLLLSFPTSYPINAPIAKFDPIVPHVNVFP-SGKVCLSILTDGWKPSINLRQIL 114 Query: 370 ESFLPQLLTYPNPIDP 417 + +LL PNP P Sbjct: 115 VG-IQKLLIEPNPESP 129 >UniRef50_A0DLZ3 Cluster: Chromosome undetermined scaffold_56, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_56, whole genome shotgun sequence - Paramecium tetraurelia Length = 231 Score = 47.6 bits (108), Expect = 1e-04 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 1/88 (1%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAW-TALYDLS 360 TPYEGG++ + P+++PF +P + + HP+I + +C IN+ + Y L Sbjct: 107 TPYEGGIYSFILKFPENFPFATPEFRALLPIKHPHI-YPNLRLCTPTINEYYEIQQYSLL 165 Query: 361 NIFESFLPQLLTYPNPIDPLNGDAAAMY 444 + +S+ L PN N +AA Y Sbjct: 166 ELLQSWYAILHREPNKFSLANCEAAEQY 193 >UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 158 Score = 47.6 bits (108), Expect = 1e-04 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 3/97 (3%) Frame = +1 Query: 184 TPYEGGVWRVRVHLP-DHYPFKS-PSIGFMNK-VYHPNIDEVSGTVCLDVINQAWTALYD 354 +P+EG + + + + YP P + F + V HPN+ +G +CLD++ AWT +Y Sbjct: 47 SPFEGFELGLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDAWTPIYT 106 Query: 355 LSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 L ++ + + LL P PL+ D A +Y E Y Sbjct: 107 LLDVVGA-IRDLLADPGLDSPLDLDIAQIYDADYEAY 142 >UniRef50_A0BSP4 Cluster: Chromosome undetermined scaffold_125, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_125, whole genome shotgun sequence - Paramecium tetraurelia Length = 1435 Score = 46.8 bits (106), Expect = 2e-04 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI 327 TPYEGG++ + +P+ YP + P I ++ HPN+ ++CLD++ Sbjct: 68 TPYEGGIFHFELLIPESYPHQPPKINLFTELPHPNV--FGNSICLDLL 113 >UniRef50_Q2U429 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus oryzae Length = 226 Score = 46.8 bits (106), Expect = 2e-04 Identities = 29/105 (27%), Positives = 45/105 (42%), Gaps = 13/105 (12%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-------------N 330 Y GG ++ + P +YPF P F +YHPNI G +C+ ++ + Sbjct: 44 YYGGYFKASMKFPKNYPFSPPEFAFRRPLYHPNI-YPDGKLCISILHAPGEDEMSGELAS 102 Query: 331 QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + W+ + ++ S L LL P N DA +PEEY Sbjct: 103 ERWSPAQRVESVLISIL-SLLDDAEVSSPANVDAGVTLRKEPEEY 146 >UniRef50_A2QMZ8 Cluster: Ubiquitin carrier protein; n=7; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 255 Score = 46.8 bits (106), Expect = 2e-04 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 13/105 (12%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVI-------------N 330 Y GG ++ + P +YP+ P F+ +YHPNI + G +C+ ++ + Sbjct: 69 YYGGYFKAIMKFPSNYPYSPPEFRFIRPLYHPNIYK-DGKLCISILHAPGEDEMSGELAS 127 Query: 331 QAWTALYDLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPEEY 465 + W+ + ++ S L LL P N DA+ M P+EY Sbjct: 128 ERWSPAQRVESVLISIL-SLLDDAEISSPANVDASVMLRKSPDEY 171 >UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os04g0580400 protein - Oryza sativa subsp. japonica (Rice) Length = 139 Score = 46.0 bits (104), Expect = 4e-04 Identities = 23/75 (30%), Positives = 39/75 (52%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 T +EGG + + + + YP +PS F + +H N+ + SG VCL +++ AW + Sbjct: 19 TDWEGGYFPLTMQFTEDYPTNAPSCKFPSGFFHINVYD-SGAVCLSILSTAWKPSITVRQ 77 Query: 364 IFESFLPQLLTYPNP 408 I + +L PNP Sbjct: 78 ILIG-IQELFDDPNP 91 >UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_11, whole genome shotgun sequence - Paramecium tetraurelia Length = 204 Score = 46.0 bits (104), Expect = 4e-04 Identities = 30/82 (36%), Positives = 42/82 (51%), Gaps = 2/82 (2%) Frame = +1 Query: 184 TPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSN 363 TPYEGGV+ V + LPD YP + V+ I + +CLDV+ W+ + + Sbjct: 45 TPYEGGVFDVELLLPDDYP-----MYIHPNVFIIQILIIWEDICLDVLKDKWSPALQIRS 99 Query: 364 IFESFLPQLLTYPNPI--DPLN 423 I + LL+Y NP DPLN Sbjct: 100 ILLQ-IQVLLSYTNPSMDDPLN 120 >UniRef50_UPI0001554972 Cluster: PREDICTED: similar to hCG2039566; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to hCG2039566 - Ornithorhynchus anatinus Length = 223 Score = 45.6 bits (103), Expect = 5e-04 Identities = 25/96 (26%), Positives = 44/96 (45%), Gaps = 6/96 (6%) Frame = +1 Query: 190 YEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQ------AWTALY 351 Y+GG ++ +PD Y P + + +++HPNI E +G +CL ++ + W Sbjct: 40 YQGGKFQFETEVPDAYNMVPPKVKCLTRIWHPNITE-TGEICLSLLREHSIDGTGWAPTR 98 Query: 352 DLSNIFESFLPQLLTYPNPIDPLNGDAAAMYLHKPE 459 L ++ N DPLN +AA ++ E Sbjct: 99 TLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHMRDKE 134 >UniRef50_A7F8T9 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 377 Score = 44.8 bits (101), Expect = 0.001 Identities = 28/88 (31%), Positives = 45/88 (51%), Gaps = 4/88 (4%) Frame = +1 Query: 175 LQVTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVIN--QAWTAL 348 L +T E G +R+ P YP + P I + + HPNI + G +C ++N + WT Sbjct: 38 LVLTVEEYGPLHMRLDFPSDYPIQPPIIKIDSNISHPNI--IRGQICASILNTPEGWTPA 95 Query: 349 YDLSNIFESFLPQLLTY--PNPIDPLNG 426 Y L + F QLL++ + I+ +NG Sbjct: 96 YTL----KGFAIQLLSFFASDAIEQVNG 119 >UniRef50_Q583A6 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=2; Trypanosoma brucei|Rep: Ubiquitin-conjugating enzyme E2, putative - Trypanosoma brucei Length = 163 Score = 44.4 bits (100), Expect = 0.001 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 2/89 (2%) Frame = +1 Query: 205 WRVRVHLPDHYPFKSPSIGFMNKVYHPNIDEVSGTVCLDVINQAWTALYDLSNIFESFLP 384 +R+ V D YP K P + F+ +Y P + E G VC + + WT +N+ L Sbjct: 68 YRLSVIFTDDYPDKPPKVSFITNIYSPLVGE-KGDVCERLTEKDWTPDQRATNVIMRVLN 126 Query: 385 QLLT-YPNPID-PLNGDAAAMYLHKPEEY 465 ++ + Y N D LN DA +PE + Sbjct: 127 EVFSGYKNNDDYDLNHDARRCLKEEPEVF 155 >UniRef50_A7EFQ5 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 367 Score = 44.4 bits (100), Expect = 0.001 Identities = 16/39 (41%), Positives = 27/39 (69%) Frame = +1 Query: 181 VTPYEGGVWRVRVHLPDHYPFKSPSIGFMNKVYHPNIDE 297 +TPYEGG++ + V+ P +YP P + F+ + HP+I+E Sbjct: 99 LTPYEGGIFWLHVYFPVNYPSHPPKMRFLTPICHPDINE 137 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 491,533,824 Number of Sequences: 1657284 Number of extensions: 10249212 Number of successful extensions: 25672 Number of sequences better than 10.0: 370 Number of HSP's better than 10.0 without gapping: 24928 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25490 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 25191138900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -