BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1010 (474 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 24 0.82 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 1.1 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 23 1.9 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 2.5 AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 21 7.7 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.8 bits (49), Expect = 0.82 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 1/48 (2%) Frame = -3 Query: 250 EYRFCSLLSNFVEFYANMAKKK*CFGQLLFRHF*VWST-RFISLFSNS 110 E FC+ + + V + N+ K L H +W T FI L +S Sbjct: 223 ELTFCNKIKHLVNLHKNLVKVAKDHNSLYSLHLLLWITVTFILLVGDS 270 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 137 CGPNSKMSKKQLTKALFFFCHIRIKL 214 C NSKM+K + LFF ++ + L Sbjct: 275 CYYNSKMTKDGVYNTLFFIVYVSLLL 300 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 22.6 bits (46), Expect = 1.9 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = +3 Query: 105 YYELENKLINLVDQTQKC 158 + L NK+ NL+D+ +C Sbjct: 212 HQNLHNKICNLIDEFNEC 229 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 2.5 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 468 DLNDFFCMRLGGPLDGLDSQISQC 397 D + CM G +DG++S I C Sbjct: 26 DCTETSCMNGGTCIDGINSYICTC 49 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 410 CESKPSRGPPKRIQKK 457 C+SK +GP R Q++ Sbjct: 171 CDSKKKKGPTPRQQEE 186 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,707 Number of Sequences: 336 Number of extensions: 2156 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -