BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1010 (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0994 + 10071081-10072163,10072704-10074530,10074977-10075054 28 3.3 07_01_0757 - 5827536-5827751,5828016-5828159 28 3.3 >08_01_0994 + 10071081-10072163,10072704-10074530,10074977-10075054 Length = 995 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 377 GNNLEYRKRNINSPLTDNLEREALFIALVDM 285 GN EY + NIN L D LE + I L D+ Sbjct: 131 GNKNEYTRENINGRLCDLLEDKNTLIVLDDL 161 >07_01_0757 - 5827536-5827751,5828016-5828159 Length = 119 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 458 IFFVCVWVAPWMV*IHKSVSVRLFIFPGNNLEYRKR 351 +FF+ VWV W+V + S F N EYRKR Sbjct: 77 LFFLVVWVIQWLVIFVMTYSA----FDDANQEYRKR 108 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,764,699 Number of Sequences: 37544 Number of extensions: 183193 Number of successful extensions: 327 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 327 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -