BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= brS-1009
(498 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC036816-1|AAH36816.1| 588|Homo sapiens thioredoxin domain cont... 29 6.8
>BC036816-1|AAH36816.1| 588|Homo sapiens thioredoxin domain
containing 3 (spermatozoa) protein.
Length = 588
Score = 29.5 bits (63), Expect = 6.8
Identities = 14/65 (21%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
Frame = +2
Query: 248 ISRIKPLSVTIGFFNAYGLANQRDQVSDFLRDHQIDIFLVQETLLKPARRD---PKIANY 418
I PL T+G + + QR+Q+ +++ D+ V++ L P + + PK+
Sbjct: 444 IQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQTEKIYPKVTGK 503
Query: 419 NMXRN 433
+ ++
Sbjct: 504 DFYKD 508
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 57,048,391
Number of Sequences: 237096
Number of extensions: 1000517
Number of successful extensions: 2209
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2082
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2207
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4536472160
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -