BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1009 (498 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036816-1|AAH36816.1| 588|Homo sapiens thioredoxin domain cont... 29 6.8 >BC036816-1|AAH36816.1| 588|Homo sapiens thioredoxin domain containing 3 (spermatozoa) protein. Length = 588 Score = 29.5 bits (63), Expect = 6.8 Identities = 14/65 (21%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +2 Query: 248 ISRIKPLSVTIGFFNAYGLANQRDQVSDFLRDHQIDIFLVQETLLKPARRD---PKIANY 418 I PL T+G + + QR+Q+ +++ D+ V++ L P + + PK+ Sbjct: 444 IQHFFPLQSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQTEKIYPKVTGK 503 Query: 419 NMXRN 433 + ++ Sbjct: 504 DFYKD 508 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,048,391 Number of Sequences: 237096 Number of extensions: 1000517 Number of successful extensions: 2209 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2082 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2207 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -