BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1008 (352 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30870.1 68415.m03762 glutathione S-transferase, putative sup... 52 1e-07 At5g41240.1 68418.m05011 glutathione S-transferase, putative sim... 50 6e-07 At3g62760.1 68416.m07050 glutathione S-transferase, putative Glu... 50 6e-07 At2g30860.1 68415.m03761 glutathione S-transferase, putative ide... 49 1e-06 At3g03190.1 68416.m00315 glutathione S-transferase, putative ide... 48 1e-06 At5g17220.1 68418.m02018 glutathione S-transferase, putative 47 3e-06 At1g49860.1 68414.m05590 glutathione S-transferase, putative sim... 46 7e-06 At5g41210.1 68418.m05008 glutathione S-transferase (GST10) ident... 46 9e-06 At5g41220.1 68418.m05009 glutathione S-transferase, putative sim... 45 2e-05 At2g02930.1 68415.m00241 glutathione S-transferase, putative 44 2e-05 At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1... 44 3e-05 At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1... 44 3e-05 At2g02380.1 68415.m00176 glutathione S-transferase, putative sim... 44 4e-05 At1g02940.1 68414.m00261 glutathione S-transferase, putative sim... 43 5e-05 At2g47730.1 68415.m05960 glutathione S-transferase 6 (GST6) iden... 42 9e-05 At4g02520.1 68417.m00345 glutathione S-transferase, putative 41 2e-04 At2g02390.3 68415.m00179 glutathione S-transferase zeta 1 (GSTZ1... 40 6e-04 At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-... 39 8e-04 At1g78360.1 68414.m09132 glutathione S-transferase, putative sim... 38 0.002 At1g02930.1 68414.m00260 glutathione S-transferase, putative sim... 36 0.006 At1g02950.2 68414.m00263 glutathione S-transferase, putative sim... 35 0.018 At1g02950.1 68414.m00262 glutathione S-transferase, putative sim... 35 0.018 At1g02920.1 68414.m00259 glutathione S-transferase, putative sim... 35 0.018 At1g57720.1 68414.m06549 elongation factor 1B-gamma, putative / ... 33 0.053 At1g27130.1 68414.m03306 glutathione S-transferase, putative sim... 32 0.093 At5g03880.1 68418.m00362 expressed protein 31 0.16 At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / ... 30 0.50 At5g27160.1 68418.m03241 hypothetical protein contains Pfam prof... 29 0.87 At5g37390.1 68418.m04498 hypothetical protein contains Pfam prof... 28 2.0 At5g33220.1 68418.m03924 hypothetical protein contains Pfam prof... 28 2.0 At4g09370.1 68417.m01546 hypothetical protein contains Pfam prof... 28 2.0 At3g47330.1 68416.m05144 hypothetical protein contains Pfam prof... 28 2.0 At2g23710.1 68415.m02831 hypothetical protein contains Pfam prof... 28 2.0 At1g23930.1 68414.m03019 hypothetical protein contains Pfam prof... 28 2.0 At4g07520.1 68417.m01174 hypothetical protein contains Pfam prof... 27 2.7 At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) fa... 27 2.7 At3g07960.1 68416.m00973 phosphatidylinositol-4-phosphate 5-kina... 27 3.5 At5g44415.1 68418.m05439 hypothetical protein contains Pfam prof... 27 4.6 At3g43120.1 68416.m04532 auxin-responsive protein-related simila... 26 6.1 At1g19570.1 68414.m02437 dehydroascorbate reductase, putative si... 26 6.1 At3g54920.1 68416.m06086 pectate lyase, putative / powdery milde... 26 8.1 >At2g30870.1 68415.m03762 glutathione S-transferase, putative supported by cDNA GI:443698 GB:D17673 Length = 215 Score = 51.6 bits (118), Expect = 1e-07 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 1/61 (1%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKY-AKGSSVYPEDPKARALVD 346 GEQ +PEYL + P +P LVD I+ESRAI+ Y+A KY ++G + + + R V+ Sbjct: 37 GEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAIMRYIAEKYRSQGPDLLGKTIEERGQVE 96 Query: 347 Q 349 Q Sbjct: 97 Q 97 >At5g41240.1 68418.m05011 glutathione S-transferase, putative similar to glutathione S-transferase, GST 10b GB:CAA10662 [Arabidopsis thaliana] 37349. Length = 591 Score = 49.6 bits (113), Expect = 6e-07 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (1%) Frame = +2 Query: 173 EQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAK-GSSVYPEDPKARALV 343 +QL PE+ ++NP VP +VD L ++ES AI+ YL++ YA YP D RA + Sbjct: 39 QQLSPEFKEINPMGKVPAIVDGRLKLFESHAILIYLSSAYASVVDHWYPNDLSKRAKI 96 >At3g62760.1 68416.m07050 glutathione S-transferase, putative Glutathione transferase III(b) - Zea mays, EMBL:AJ010296 Length = 219 Score = 49.6 bits (113), Expect = 6e-07 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 2/55 (3%) Frame = +2 Query: 185 PEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSV-YPEDPKARALV 343 P +L +NP VP L DD L+++ESRAI Y+A K+ KG+ + EDPK A+V Sbjct: 43 PSFLSMNPFGKVPALQDDDLTLFESRAITAYIAEKHRDKGTDLTRHEDPKEAAIV 97 >At2g30860.1 68415.m03761 glutathione S-transferase, putative identical to GB:Y12295 Length = 215 Score = 48.8 bits (111), Expect = 1e-06 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKY-AKGSSVYPEDPKARALVD 346 GE +P YL L P TVP +VD I+ESRA++ Y+A KY ++G + + + R V+ Sbjct: 37 GEHKQPAYLALQPFGTVPAVVDGDYKIFESRAVMRYVAEKYRSQGPDLLGKTVEDRGQVE 96 Query: 347 Q 349 Q Sbjct: 97 Q 97 >At3g03190.1 68416.m00315 glutathione S-transferase, putative identical to glutathione S-transferase GB:AAB09584 from [Arabidopsis thaliana] Length = 214 Score = 48.4 bits (110), Expect = 1e-06 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 173 EQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSVYPEDPKARALVDQ 349 EQ KP++L P VP + D L ++ESRAI Y A KYA +G+ + + + RA+VDQ Sbjct: 39 EQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTDLLGKTLEGRAIVDQ 98 >At5g17220.1 68418.m02018 glutathione S-transferase, putative Length = 214 Score = 47.2 bits (107), Expect = 3e-06 Identities = 25/60 (41%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 173 EQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSVYPEDPKARALVDQ 349 EQ KPE+L P VP + D ++ESRAI Y A K+A +G+++ + + RA+VDQ Sbjct: 39 EQKKPEHLLRQPFGQVPAIEDGDFKLFESRAIARYYATKFADQGTNLLGKSLEHRAIVDQ 98 >At1g49860.1 68414.m05590 glutathione S-transferase, putative similar to GI:860955 from [Hyoscyamus muticus] (Plant Physiol. 109 (1), 253-260 (1995)) Length = 254 Score = 46.0 bits (104), Expect = 7e-06 Identities = 25/60 (41%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +2 Query: 170 GEQLKPEYLK-LNPQHTVPTLVDDGLSIWESRAIITYLANKYAK-GSSVYPEDPKARALV 343 GE +L LNP VP L D L ++E +AI YLA +Y G+++ P+DPK RA++ Sbjct: 40 GEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNLLPDDPKKRAIM 99 >At5g41210.1 68418.m05008 glutathione S-transferase (GST10) identical to glutathione transferase AtGST 10 [Arabidopsis thaliana] GI:4049401 Length = 245 Score = 45.6 bits (103), Expect = 9e-06 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%) Frame = +2 Query: 173 EQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKY-AKGSSVYPEDPKARALV 343 +QL PE+ +NP VP +VD L ++ES AI+ YL++ + + YP D RA + Sbjct: 40 QQLSPEFKDINPLGKVPAIVDGRLKLFESHAILIYLSSAFPSVADHWYPNDLSKRAKI 97 >At5g41220.1 68418.m05009 glutathione S-transferase, putative similar to emb|CAA10662 Length = 590 Score = 44.8 bits (101), Expect = 2e-05 Identities = 23/58 (39%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 173 EQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKY-AKGSSVYPEDPKARALV 343 +QL PE+ +NP VP +VD L + ES AI+ YL++ Y + YP D RA + Sbjct: 39 QQLSPEFKDINPMGKVPAIVDGKLKLSESHAILIYLSSAYPSVVDHWYPTDLSKRARI 96 >At2g02930.1 68415.m00241 glutathione S-transferase, putative Length = 212 Score = 44.4 bits (100), Expect = 2e-05 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSVYPEDPK 328 GE K +L NP VP D L ++ESRAI Y+A++Y +G+++ P D K Sbjct: 39 GEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLPADSK 92 >At2g02390.2 68415.m00177 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 191 Score = 44.0 bits (99), Expect = 3e-05 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARAL 340 G+Q ++ K+NP TVP LVD + I +S AII YL KY + + P D RA+ Sbjct: 44 GDQFDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKYPE-PPLLPRDLHKRAV 99 >At2g02390.1 68415.m00178 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 221 Score = 44.0 bits (99), Expect = 3e-05 Identities = 24/57 (42%), Positives = 33/57 (57%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARAL 340 G+Q ++ K+NP TVP LVD + I +S AII YL KY + + P D RA+ Sbjct: 44 GDQFDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKYPE-PPLLPRDLHKRAV 99 >At2g02380.1 68415.m00176 glutathione S-transferase, putative similar to gi:167970 gb:AAA72320 gb:AY052332 Length = 223 Score = 43.6 bits (98), Expect = 4e-05 Identities = 24/57 (42%), Positives = 34/57 (59%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARAL 340 G+Q ++ K+NP TVP LVD + I +S AII YL +KY + + P D RA+ Sbjct: 47 GDQSDSDFKKINPMGTVPALVDGDVVINDSFAIIMYLDDKYPE-PPLLPSDYHKRAV 102 >At1g02940.1 68414.m00261 glutathione S-transferase, putative similar to glutathione S-transferase GI:860955 from [Hyoscyamus muticus] Length = 256 Score = 43.2 bits (97), Expect = 5e-05 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLA 283 G+Q KP +L +NP VP +D GL + ESRAI Y+A Sbjct: 74 GDQKKPSFLAINPFGQVPVFLDGGLKLTESRAISEYIA 111 >At2g47730.1 68415.m05960 glutathione S-transferase 6 (GST6) identical to GB:X95295. Based on identical cDNA hits, the translation is now 40 AAs longer at the N-terminal, and start of exon2 is also corrected. Length = 263 Score = 42.3 bits (95), Expect = 9e-05 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSVYPEDPK 328 G + +L LNP +P L D L+++ESRAI YLA +Y+ KG + +D K Sbjct: 87 GAHKQEAHLALNPFGQIPALEDGDLTLFESRAITQYLAEEYSEKGEKLISQDCK 140 >At4g02520.1 68417.m00345 glutathione S-transferase, putative Length = 212 Score = 41.1 bits (92), Expect = 2e-04 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSVYPEDPK 328 GE K +L NP VP D L ++ESRAI Y+A++Y +G+++ D K Sbjct: 39 GEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQYIAHRYENQGTNLLQTDSK 92 >At2g02390.3 68415.m00179 glutathione S-transferase zeta 1 (GSTZ1) (GST18) identical to SP|Q9ZVQ3|GTZ1_ARATH Glutathione S-transferase zeta-class 1 (EC 2.5.1.18) (AtGSTZ1) (Maleylacetone isomerase) (EC 5.2.1.-) (MAI) {Arabidopsis thaliana}; contains Pfam profiles PF02798: Glutathione S-transferase, N-terminal domain and PF00043:Glutathione S-transferase, C-terminal domain Length = 228 Score = 39.5 bits (88), Expect = 6e-04 Identities = 22/51 (43%), Positives = 30/51 (58%) Frame = +2 Query: 188 EYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARAL 340 ++ K+NP TVP LVD + I +S AII YL KY + + P D RA+ Sbjct: 57 DFKKINPMGTVPALVDGDVVINDSFAIIMYLDEKYPE-PPLLPRDLHKRAV 106 >At5g02790.1 68418.m00221 In2-1 protein, putative similar to In2-1, Zea mays, EMBL:X58573 Length = 235 Score = 39.1 bits (87), Expect = 8e-04 Identities = 21/51 (41%), Positives = 30/51 (58%) Frame = +2 Query: 197 KLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARALVDQ 349 K+ P++ VP L +G I ES +I YL N + +G S+YPED R D+ Sbjct: 73 KVYPENKVPALEHNGKIIGESLDLIKYLDNTF-EGPSLYPEDHAKREFGDE 122 >At1g78360.1 68414.m09132 glutathione S-transferase, putative similar to glutathione transferase GI:2853219 from [Carica papaya] Length = 222 Score = 37.9 bits (84), Expect = 0.002 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%) Frame = +2 Query: 185 PEYLKLNPQH-TVPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARA 337 P L++NP H T+P L+ +G + ES I Y+ ++ +S P DP RA Sbjct: 43 PLLLEMNPIHKTIPVLIHNGKPVLESLIQIQYIDEVWSDNNSFLPSDPYHRA 94 >At1g02930.1 68414.m00260 glutathione S-transferase, putative similar to glutathione S-transferase GI:860955 from [Hyoscyamus muticus] Length = 208 Score = 36.3 bits (80), Expect = 0.006 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSV 310 GE K ++ NP VP D I+ESRAI Y+A++++ KG+++ Sbjct: 39 GEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQYIAHEFSDKGNNL 86 >At1g02950.2 68414.m00263 glutathione S-transferase, putative similar to glutathione-S-transferase GI:169887 from [Silene vulgaris] Length = 245 Score = 34.7 bits (76), Expect = 0.018 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLA 283 GE +L LNP VP D + ++ESRAI Y+A Sbjct: 62 GEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIA 99 >At1g02950.1 68414.m00262 glutathione S-transferase, putative similar to glutathione-S-transferase GI:169887 from [Silene vulgaris] Length = 243 Score = 34.7 bits (76), Expect = 0.018 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLA 283 GE +L LNP VP D + ++ESRAI Y+A Sbjct: 60 GEHKTEPFLSLNPFGQVPVFEDGSVKLYESRAITQYIA 97 >At1g02920.1 68414.m00259 glutathione S-transferase, putative similar to glutathione S-transferase GI:860955 from [Hyoscyamus muticus]; supported by cDNA GI:443697. Length = 209 Score = 34.7 bits (76), Expect = 0.018 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 1/48 (2%) Frame = +2 Query: 170 GEQLKPEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYA-KGSSV 310 GE K ++ NP VP D ++ESRAI Y+A+ Y+ KG+ + Sbjct: 39 GEHKKEPFIFRNPFGKVPAFEDGDFKLFESRAITQYIAHFYSDKGNQL 86 >At1g57720.1 68414.m06549 elongation factor 1B-gamma, putative / eEF-1B gamma, putative similar to elongation factor 1B gamma GI:3868758 from [Oryza sativa] Length = 413 Score = 33.1 bits (72), Expect = 0.053 Identities = 17/40 (42%), Positives = 22/40 (55%) Frame = +2 Query: 185 PEYLKLNPQHTVPTLVDDGLSIWESRAIITYLANKYAKGS 304 PE+LK+NP VP L I+ES AI Y++ K S Sbjct: 43 PEFLKMNPIGKVPVLETPEGPIFESNAIARYVSRKNGDNS 82 >At1g27130.1 68414.m03306 glutathione S-transferase, putative similar to glutathione S-transferase GB: AAF22517 GI:6652870 from [Papaver somniferum] Length = 227 Score = 32.3 bits (70), Expect = 0.093 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +2 Query: 194 LKLNPQHT-VPTLVDDGLSIWESRAIITYLANKYAKGSSVYPEDPKARA 337 LK NP H VP L+ LSI ES ++ Y+ + S+ P D RA Sbjct: 49 LKSNPIHKKVPVLLHGDLSISESLNVVQYVDEAWPSVPSILPSDAYDRA 97 >At5g03880.1 68418.m00362 expressed protein Length = 339 Score = 31.5 bits (68), Expect = 0.16 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +2 Query: 182 KPEYLKLNPQHTVPTLVDD--GLSIWESRAIITYLANKYAKGS 304 +P+ ++ + P +VD G+S++ES II YL+ KY G+ Sbjct: 181 RPKVKQMGGKQQFPYMVDPNTGVSMYESDGIIKYLSEKYGDGT 223 >At1g09640.1 68414.m01081 elongation factor 1B-gamma, putative / eEF-1B gamma, putative Similar to elongation factor 1-gamma (gb|EF1G_XENLA). ESTs gb|T20564,gb|T45940,gb|T04527 come from this gene Length = 414 Score = 29.9 bits (64), Expect = 0.50 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 185 PEYLKLNPQHTVPTLVDDGLSIWESRAIITYLA 283 P +LK+NP VP L S++ES AI Y++ Sbjct: 43 PAFLKMNPIGKVPVLETPEGSVFESNAIARYVS 75 >At5g27160.1 68418.m03241 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 702 Score = 29.1 bits (62), Expect = 0.87 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = -1 Query: 271 DDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 DDG G D +VD R+R+++ + +IFW ++F Sbjct: 412 DDGIGFVD--PVVDSWRNRLIKERKRIFWKDMF 442 >At5g37390.1 68418.m04498 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 628 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 443 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 482 >At5g33220.1 68418.m03924 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 587 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 472 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 511 >At4g09370.1 68417.m01546 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 666 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 443 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 482 >At3g47330.1 68416.m05144 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 664 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 443 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 482 >At2g23710.1 68415.m02831 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287; this may be a pseudogene; the protein appears slightly truncated on the 3' end due to intervening stop codon. Length = 592 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 443 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 482 >At1g23930.1 68414.m03019 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 649 Score = 27.9 bits (59), Expect = 2.0 Identities = 17/42 (40%), Positives = 25/42 (59%) Frame = -1 Query: 298 LSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 LS +V + DDG G D IVD R+R++ + +IFW L+ Sbjct: 424 LSRVVEKHVDDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 463 >At4g07520.1 68417.m01174 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 734 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -1 Query: 271 DDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 DDG G D +VD R+R+++ + + FW ++F Sbjct: 417 DDGIGFVD--PVVDSWRNRLIKERKRFFWKDMF 447 >At2g34990.1 68415.m04293 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 302 Score = 27.5 bits (58), Expect = 2.7 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = +1 Query: 88 LCALQGCTADSEGAQLKPEPQTGRPTPRGTAQTRIFEVEPSTHGPDPSRRWSFNLGVPRH 267 LC + C E + L PEP T + +F+ T+ PSR WS L R Sbjct: 136 LCRVDLCLQPGERSYLNPEPDLVEST-----NSHLFDGVTWTNRNRPSRSWSTRLSQCRV 190 Query: 268 HHLL 279 +L Sbjct: 191 SQIL 194 >At3g07960.1 68416.m00973 phosphatidylinositol-4-phosphate 5-kinase family protein similar to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profiles PF01504: Phosphatidylinositol-4-phosphate 5-Kinase, PF02493: MORN repeat Length = 715 Score = 27.1 bits (57), Expect = 3.5 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 145 PQTGRPTPRGTAQTRIFEVEPSTHGPDPSRRWSFNLGV 258 P +G TP G ++TR+ E D S+ S LG+ Sbjct: 591 PTSGARTPTGNSETRLSRAEMDRFLLDASKLASIKLGI 628 >At5g44415.1 68418.m05439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 611 Score = 26.6 bits (56), Expect = 4.6 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = -1 Query: 301 ALSVLVRQVGDDGAGLPD*KTIVD*GRDRVLRVQLQIFWFELF 173 AL + + V DDG G D IVD R+R++ + +IFW L+ Sbjct: 388 ALGDITKHV-DDGIGYID--PIVDSWRERLIVEKKKIFWRSLY 427 >At3g43120.1 68416.m04532 auxin-responsive protein-related similar to indole-3-acetic acid induced protein ARG7 (SP:P32295) from [Phaseolus aureus] Length = 160 Score = 26.2 bits (55), Expect = 6.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 70 PVLRSRLCALQGCTADSEGAQLKPEPQTGRP 162 PV+ RL L+ C +D E PEP P Sbjct: 50 PVINKRLLDLKTCDSDEETTCQSPEPPPDVP 80 >At1g19570.1 68414.m02437 dehydroascorbate reductase, putative similar to GB:BAA90672 from (Oryza sativa) Length = 213 Score = 26.2 bits (55), Expect = 6.1 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +2 Query: 182 KPE-YLKLNPQHTVPTLVDDGLSIWESRAIITYLANKY 292 KP+ +L ++PQ VP L D + +S I+ L KY Sbjct: 47 KPQWFLDISPQGKVPVLKIDDKWVTDSDVIVGILEEKY 84 >At3g54920.1 68416.m06086 pectate lyase, putative / powdery mildew susceptibility protein (PMR6) identical to powdery mildew susceptibility protein [Arabidopsis thaliana] GI:22506901; similar to pectate lyase 2 GP:6606534 from [Musa acuminata] Length = 501 Score = 25.8 bits (54), Expect = 8.1 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +2 Query: 278 LANKYAKGSSVYPEDPKARALVDQ 349 +++ Y+K SSV DPKA +LVDQ Sbjct: 384 MSSMYSKASSV---DPKAASLVDQ 404 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,150,412 Number of Sequences: 28952 Number of extensions: 133000 Number of successful extensions: 402 Number of sequences better than 10.0: 41 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 402 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 439384704 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -