BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1007 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40330| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 33 0.12 SB_3222| Best HMM Match : DUF733 (HMM E-Value=4.2) 30 1.4 SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) 29 1.9 SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) 27 7.6 SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) 27 7.6 SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) 27 7.6 SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17) 27 7.6 SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 27 7.6 >SB_40330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 35.9 bits (79), Expect = 0.022 Identities = 24/73 (32%), Positives = 35/73 (47%) Frame = +2 Query: 146 SSNTTQAYSIRVDGTALSSYQATTLSTRCG*TYIWTTILRRLSPQPSTAGHRPLPIYTTE 325 S +T +Y+ T+ +SY +TT T C +Y TT + T + P P YT+ Sbjct: 73 SYTSTTSYTSTTSYTSTTSYTSTTSYT-CTTSYTSTTSYTSTTSYTPTTSYTPTPSYTST 131 Query: 326 PGLRLSSSTSCRP 364 P +SSTS P Sbjct: 132 PS--YTSSTSYTP 142 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 33.5 bits (73), Expect = 0.12 Identities = 20/67 (29%), Positives = 31/67 (46%) Frame = +2 Query: 158 TQAYSIRVDGTALSSYQATTLSTRCG*TYIWTTILRRLSPQPSTAGHRPLPIYTTEPGLR 337 T +Y+ T+ +SY TT T +Y TT + ST + P P YT+ P Sbjct: 140 TPSYTSTTSYTSTTSYTPTTSYTPTP-SYTSTTSYTSTTSYTSTTSYTPTPSYTSTPSYT 198 Query: 338 LSSSTSC 358 ++S +C Sbjct: 199 STTSYTC 205 >SB_3222| Best HMM Match : DUF733 (HMM E-Value=4.2) Length = 399 Score = 29.9 bits (64), Expect = 1.4 Identities = 13/43 (30%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = +2 Query: 257 ILRRLSPQPST-AGHRPLPIYTTEPGLRLSSSTSCRPPCGGHR 382 I+R++SP T P P +T + + + C P CG H+ Sbjct: 174 IIRKISPNQETEVAGPPFPSFTPSTSNQKADNNVCPPTCGHHQ 216 >SB_41994| Best HMM Match : F-box (HMM E-Value=1.4e-06) Length = 1020 Score = 29.5 bits (63), Expect = 1.9 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +1 Query: 181 RWYGVIKLSSDYTIHSLWLNIHLDNYSEALKPTAVH 288 RWY +L+ D SLW ++ L YS L+P A+H Sbjct: 590 RWY---RLTQD---SSLWTDLDLAQYSTKLQPAAIH 619 >SB_30470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 912 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 2/31 (6%) Frame = +2 Query: 293 GH-RPLPIYTTEPGLRLS-SSTSCRPPCGGH 379 GH RP P+++TEP +R++ ST R G H Sbjct: 742 GHTRPYPVFSTEPYIRVTLQSTESRIVSGNH 772 >SB_4090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2342 Score = 28.7 bits (61), Expect = 3.3 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +2 Query: 293 GHRP--LPIYTTEPGLRLSSSTSCRPPCGG 376 G+RP LP+ T GL + +TSC P GG Sbjct: 463 GYRPEKLPLRRTPDGLAILDNTSCGPVFGG 492 >SB_58242| Best HMM Match : PUCC (HMM E-Value=0.14) Length = 784 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/58 (25%), Positives = 28/58 (48%) Frame = +1 Query: 112 TQPALVSPCPSVFEYDTSIQHPGRWYGVIKLSSDYTIHSLWLNIHLDNYSEALKPTAV 285 T P + P S + TSIQHPG +Y S +++ +H + +++ T++ Sbjct: 122 TAPRSILPVYSTPVHTTSIQHPGPYYQYTAPRSILPVYN--TPVHTTDIQHSVRTTSI 177 >SB_41962| Best HMM Match : RVT_1 (HMM E-Value=1.4e-18) Length = 1052 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 201 AIKRLHYPLVVVEHTSGQL 257 A+KR+HYP+V +E + +L Sbjct: 231 ALKRVHYPMVTIEEVADKL 249 >SB_28319| Best HMM Match : zf-C2H2 (HMM E-Value=0.012) Length = 179 Score = 27.5 bits (58), Expect = 7.6 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -3 Query: 524 TNINKLTLDN*IKLNCLVYFE*YWSYTIIYRYSSSGIRNVGRPLARWCD 378 ++ + + LDN KLNC +Y + Y +I S++G+ N L + D Sbjct: 49 SSCDPVKLDNTSKLNCFLYAD----YLVILSDSATGLENCLHKLKMYAD 93 >SB_17388| Best HMM Match : rve (HMM E-Value=8.2e-17) Length = 441 Score = 27.5 bits (58), Expect = 7.6 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +2 Query: 104 KRRRSPRWCLRALVSSNTTQAYSIRVDGTALSSYQATTLSTRCG*TYIWTTILRRLSPQP 283 KRR++P W A S + + D A+ + L C TY +T + ++ Q Sbjct: 2 KRRKTPSWRTLAPALSPSATQLAACCDAAAVPALHLGGLFPYCAYTYAYTYTYKMIADQF 61 Query: 284 STAGH 298 +A H Sbjct: 62 WSAMH 66 >SB_14466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1052 Score = 27.5 bits (58), Expect = 7.6 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +3 Query: 201 AIKRLHYPLVVVEHTSGQL 257 A+KR+HYP+V +E + +L Sbjct: 231 ALKRVHYPMVTIEEVADKL 249 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 27.5 bits (58), Expect = 7.6 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = -1 Query: 340 EPQTGLSGVDWERPMSSSGRLW 275 +PQ +S VDW+RP SG+ W Sbjct: 1134 QPQNTVS-VDWDRPEVDSGKSW 1154 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,258,734 Number of Sequences: 59808 Number of extensions: 387352 Number of successful extensions: 855 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -