BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1004 (681 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putativ... 84 7e-17 >At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putative similar to NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (Swiss-Prot:Q01300) [Petunia hybrida] Length = 99 Score = 84.2 bits (199), Expect = 7e-17 Identities = 40/99 (40%), Positives = 61/99 (61%), Gaps = 2/99 (2%) Frame = +1 Query: 31 LGYIQIRKGPNKVGFIGLLQPFSDAIKLFTKERTYPNFSNYFCYYFSPVFRFIXXXXXXX 210 + ++Q RKGP+ VG GLLQP +D KL KE P+ +N+F + +PV F+ Sbjct: 1 MAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFFLFRMAPVATFMLSLVARA 60 Query: 211 XIPYIYNLICF--NLGILFFLCLTSLGVYIVIIAGWSSN 321 +P+ Y ++ N+G+L+ ++SLGVY +IIAG SSN Sbjct: 61 VVPFDYGMVLSDPNIGLLYLFAISSLGVYGIIIAGRSSN 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,643,720 Number of Sequences: 28952 Number of extensions: 102859 Number of successful extensions: 266 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 249 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 265 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -