BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= brS-1001 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0253 - 27901204-27901251,27901673-27901744,27901944-279020... 28 6.2 >01_06_0253 - 27901204-27901251,27901673-27901744,27901944-27902030, 27902484-27902574,27903706-27903769,27904354-27904461, 27905124-27905181,27905813-27905956,27906307-27906372, 27907227-27907299,27908439-27908500,27908923-27909000, 27909124-27909229,27909317-27909483,27909961-27910048, 27911204-27911313,27911833-27911928,27912354-27912461, 27912568-27912711,27913850-27914065 Length = 661 Score = 28.3 bits (60), Expect = 6.2 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 7/112 (6%) Frame = -2 Query: 439 RPLRISFLYFKLFYIYVLN*HTVKVINAICNRIFFFPLSQY------LIFMARLGI*MNC 278 R +R F+Y +L +++ LN + ++N + ++ SQ+ L F+ +L Sbjct: 91 RAMRFYFVYLRLDWLWSLNLFALILLNFLEKPLWCRGYSQHACDQRDLYFLGQLPYLSKT 150 Query: 277 CS*V*NSITT*PIWLILVLNYLWK-SREGLKGS*YENARN*LKITILFVL*C 125 S + +T +ILV++ + S EGL ++N N LK+ +LF+L C Sbjct: 151 ESLIYEGLTL----VILVMDIFYPLSYEGLNLF-WKNTINKLKVLLLFILAC 197 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,261,953 Number of Sequences: 37544 Number of extensions: 293966 Number of successful extensions: 464 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 454 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 464 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -